[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yheJ
DDBJ      :yheJ         hypothetical protein; orphan
Swiss-Prot:YHEJ_BACSU   RecName: Full=Uncharacterized protein yheJ;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:53 amino acids
:PSIPRED
:HMM:PFM   19->43 PF03108 * MuDR 0.00033 28.0 25/67  
:BLT:SWISS 1->53 YHEJ_BACSU 1e-26 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12809.1 GT:GENE yheJ GT:PRODUCT hypothetical protein; orphan GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1045037..1045198 GB:FROM 1045037 GB:TO 1045198 GB:DIRECTION + GB:GENE yheJ GB:PRODUCT hypothetical protein; orphan GB:NOTE Evidence 6: Doubtful CDS GB:PROTEIN_ID CAB12809.1 GB:DB_XREF SubtiList:BG13042 UniProtKB/Swiss-Prot:O07551 GB:GENE:GENE yheJ LENGTH 53 SQ:AASEQ MFIKQFHIGAANLLFCFRERFFRSDRALKSAVRNISVKKGMELTLHAFFIYKI GT:EXON 1|1-53:0| SW:ID YHEJ_BACSU SW:DE RecName: Full=Uncharacterized protein yheJ; SW:GN Name=yheJ; OrderedLocusNames=BSU09700; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->53|YHEJ_BACSU|1e-26|100.0|53/100| HM:PFM:NREP 1 HM:PFM:REP 19->43|PF03108|0.00033|28.0|25/67|MuDR| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHccEEEEEEEEEEEc //