[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yheN
DDBJ      :yheN         putative polysaccharide deacetylase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  320/915 : Eukaryota  48/199 : Viruses  0/175   --->[See Alignment]
c.6.2
:282 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   85->282 2c1gA PDBj 1e-27 39.1 %
:RPS:PDB   84->277 2cc0A PDBj 2e-36 27.5 %
:RPS:SCOP  81->275 1ny1A  c.6.2.3 * 3e-40 30.5 %
:HMM:SCOP  72->277 2iw0A1 c.6.2.3 * 8.3e-48 35.1 %
:RPS:PFM   85->198 PF01522 * Polysacc_deac_1 5e-13 34.5 %
:HMM:PFM   80->205 PF01522 * Polysacc_deac_1 2.4e-31 35.2 122/124  
:HMM:PFM   51->87 PF04494 * TFIID_90kDa 0.00063 21.6 37/143  
:BLT:SWISS 85->268 YJEA_BACSU 6e-21 37.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12805.1 GT:GENE yheN GT:PRODUCT putative polysaccharide deacetylase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1040861..1041709) GB:FROM 1040861 GB:TO 1041709 GB:DIRECTION - GB:GENE yheN GB:PRODUCT putative polysaccharide deacetylase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB12805.1 GB:DB_XREF GOA:O07596 InterPro:IPR002509 SubtiList:BG13046 UniProtKB/TrEMBL:O07596 GB:GENE:GENE yheN LENGTH 282 SQ:AASEQ MRQTRGEASPSAVSLAFKFASLAVLCVLLLLMVILGYSNSSTKAKEVTVTTNGQLRDEKESLKLKNDSPDLLIKHLQTKQNMGDKTVYLTFDDGPSAVTTRLLDVLKSADVKATFFMLSPRMNEFKQAVKRAEKEGHALGLHGVTHNNRLFYQTPTSPLKEMQEARDTLQDITGYKTDLVRTPYGSKPSLTASQIRNLEKDGFVYWDWTIDSMDWKYRNSQYVTAVLQQLENMEHSSSSRPNVILMHDLPATVNALPVLINKLKEKGYSFGVLEDTMVPVHE GT:EXON 1|1-282:0| BL:SWS:NREP 1 BL:SWS:REP 85->268|YJEA_BACSU|6e-21|37.1|170/467| TM:NTM 1 TM:REGION 13->35| SEG 22->35|lavlcvllllmvil| BL:PDB:NREP 1 BL:PDB:REP 85->282|2c1gA|1e-27|39.1|184/384| RP:PDB:NREP 1 RP:PDB:REP 84->277|2cc0A|2e-36|27.5|182/192| RP:PFM:NREP 1 RP:PFM:REP 85->198|PF01522|5e-13|34.5|113/123|Polysacc_deac_1| HM:PFM:NREP 2 HM:PFM:REP 80->205|PF01522|2.4e-31|35.2|122/124|Polysacc_deac_1| HM:PFM:REP 51->87|PF04494|0.00063|21.6|37/143|TFIID_90kDa| GO:PFM:NREP 2 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01522|IPR002509| GO:PFM GO:0016810|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds"|PF01522|IPR002509| RP:SCP:NREP 1 RP:SCP:REP 81->275|1ny1A|3e-40|30.5|187/235|c.6.2.3| HM:SCP:REP 72->277|2iw0A1|8.3e-48|35.1|202/0|c.6.2.3|1/1|Glycoside hydrolase/deacetylase| OP:NHOMO 939 OP:NHOMOORG 370 OP:PATTERN --------------------------------------------------11---------------- 232-511-------11111-11111-11111111111---1221-1------12------1133-1-5742-222----212------1112-111----1222-222-1--------------------------122-1111--211111-22--------1-1-2242------------112--1--445A9A9A9AB8A9AAC9555574AAB54573241111128B--------------------2-1-11---------11------11211111111111111111111111111-1111111111---11112468A666666666639885666543-152352446533332322321-11--1---------121232223332-----------------1---11-111-111111--42----1------1--------------1---------------------------1111--11-1-----1--1-21------12------111-11---11--1----1111-1-----------------1---2-------1--111--1-------11-1-1-----------------------------------1----------------------1--------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------11122222222222-------------------------1-------------------------1-1111-1 ------------8B2-25211--111-------2121111111---1--23333445-2222--1-----------11-1-----1------2521----1--A58-----------------------------------------------------------------------------------3--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 236 STR:RPRED 83.7 SQ:SECSTR ##############################################EEEEEEEcTTccccGGGTcccccccccTTcccccTcccEEEEEEEEccccTTHHHHHHHHHHTTcccEEEEcHHHHHHcHHHHHHHHHTTcEEEEccccccccGGGccHHHHHHHHHHHHHHHHHTTcccccEEccGGGcTTcccHHHHHHHHHTTcEEccccEEccGGGTccHHHHHHHHHTccTccccGGcTTcEEEEEccHHHHHHHHHHHHHHHHTTEEEcEEcTTTTcccc DISOP:02AL 1-13, 43-63, 279-282| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHccccccccccHHHHHHHccccccccccEEEEEEcccccccHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHcccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHcccEEEEccccccccccccHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHHHHHcccEEEEHHHHHccccc //