[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhfA
DDBJ      :yhfA         putative transporter
Swiss-Prot:YHFA_BACSU   RecName: Full=Uncharacterized membrane protein yhfA;

Homologs  Archaea  0/68 : Bacteria  58/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:463 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   254->301 PF10854 * DUF2649 0.00017 33.3 45/67  
:BLT:SWISS 1->463 YHFA_BACSU 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12848.1 GT:GENE yhfA GT:PRODUCT putative transporter GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1081413..1082804) GB:FROM 1081413 GB:TO 1082804 GB:DIRECTION - GB:GENE yhfA GB:PRODUCT putative transporter GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pt: putative transporter GB:PROTEIN_ID CAB12848.1 GB:DB_XREF SubtiList:BG13047 UniProtKB/Swiss-Prot:O07599 GB:GENE:GENE yhfA LENGTH 463 SQ:AASEQ MMEVGILPVHVLYVFFIGAIILFMLLRKDTTFISLFGIFIISLWASHSLSASVSSLFHSFIYAAGELLPTIFIICFIVSMSDLLTKTGINEAMISPFASLVRGPVTAYWLIGGLMFAISLFFWPSPGVALIGAVLLPAAARAGLTPLAAAMAMNLFGHGFALSGDFVIQAAPKLTADAAGIPVGDVVSASIPLVLIMGVTTTTAAFIMIQRERKKQEHPTSFSPVLSGEQDNSLYLPKRLRSILAFLIPLAFLADIACMLLFNLQGNDATALIGGSAICILFTVHFFVYKHKGLEKITGYFIDGFKFGFKVFGPVIPIAAFFYLGDSGYESILGTSLPKGSHGIVNDLGIALSHMMPMSKELAATALTAAGAITGLDGSGFSGISLAGSIAKLFSSALHADPAILTALGQISAIWVGGGTLVPWALIPAAAICKVDPFELARKNFIPVAIGLLVTTLAAVMML GT:EXON 1|1-463:0| SW:ID YHFA_BACSU SW:DE RecName: Full=Uncharacterized membrane protein yhfA; SW:GN Name=yhfA; OrderedLocusNames=BSU10080; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->463|YHFA_BACSU|0.0|100.0|463/100| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 9 TM:REGION 4->26| TM:REGION 29->51| TM:REGION 56->78| TM:REGION 113->135| TM:REGION 182->204| TM:REGION 241->263| TM:REGION 307->329| TM:REGION 409->431| TM:REGION 444->463| SEG 32->60|fislfgifiislwashslsasvsslfhsf| SEG 135->153|llpaaaragltplaaamam| SEG 243->257|ilafliplafladia| SEG 304->313|gfkfgfkvfg| SEG 362->378|laataltaagaitgldg| HM:PFM:NREP 1 HM:PFM:REP 254->301|PF10854|0.00017|33.3|45/67|DUF2649| OP:NHOMO 62 OP:NHOMOORG 58 OP:PATTERN -------------------------------------------------------------------- -------------------------1------1-----21----------------------1----------------------------------------------------------------------------------------------------------------------------------111111111-1111111111-111-11111--------11-------------------------------------------------------------------------------------------11-1-------1---1111----1------1-11-----1--111------------------------------------------------------------------------------------------------------------------------------------2-2------------------------21111-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 211-235| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccHHHHccHHHHHccccHHHHHHHHHHHcccccccccHHEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHEEEcccHHHHHHHHHHHHHccccHHHHHHHccHHHHHHHHHHHHHHHHHc //