[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhfE
DDBJ      :yhfE         putative endoglucanase
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  227/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.49.3c.56.5d.327.1
:346 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->343 2greA PDBj e-116 70.4 %
:RPS:PDB   7->343 2cf4A PDBj 9e-24 14.3 %
:RPS:SCOP  20->90 2i09A2  d.327.1.1 * 4e-19 15.5 %
:RPS:SCOP  73->185 2greA1  b.49.3.1 * 2e-25 71.3 %
:RPS:SCOP  166->343 1yloA2  c.56.5.4 * 6e-26 19.0 %
:HMM:SCOP  5->343 1vhoA2 c.56.5.4 * 6.8e-54 34.7 %
:RPS:PFM   48->336 PF05343 * Peptidase_M42 2e-43 40.9 %
:HMM:PFM   48->336 PF05343 * Peptidase_M42 5.8e-93 37.1 283/292  
:BLT:SWISS 1->330 YSDC_BACSU 7e-18 26.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12860.1 GT:GENE yhfE GT:PRODUCT putative endoglucanase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1095063..1096103 GB:FROM 1095063 GB:TO 1096103 GB:DIRECTION + GB:GENE yhfE GB:PRODUCT putative endoglucanase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB12860.1 GB:DB_XREF GOA:O07603 InterPro:IPR008007 SubtiList:BG13051 UniProtKB/TrEMBL:O07603 GB:GENE:GENE yhfE LENGTH 346 SQ:AASEQ MTSVRKTMELIKELVSIPSPTGNTYEVINYIESLLKEWKVETVRNHKGGLIATLPGRDTSRHRMLTAHVDTLGAMVKEIKADGRLKIDLIGGFRYNSIEGEYCQIETASGKMYTGTILMHQTSVHVYKDAGKAERNQENMEIRLDEPVHCRKDTEELGIGVGDFVSFDPRVEITSSGFIKSRHLDDKASVALLLRLIHEIQTEDIELPYTTHFLISNNEEIGYGGNSNIPPETVEYLAVDMGAIGDGQATDEYSVSICVKDASGPYHYQLRKHLVQLAEKHHIDYKLDIYPYYGSDASAAIKSGHDIVHGLIGPGIDASHAFERTHKSSLRHTAKLLYYYVQSPMV GT:EXON 1|1-346:0| BL:SWS:NREP 1 BL:SWS:REP 1->330|YSDC_BACSU|7e-18|26.3|316/361| BL:PDB:NREP 1 BL:PDB:REP 6->343|2greA|e-116|70.4|301/307| RP:PDB:NREP 1 RP:PDB:REP 7->343|2cf4A|9e-24|14.3|321/327| RP:PFM:NREP 1 RP:PFM:REP 48->336|PF05343|2e-43|40.9|281/292|Peptidase_M42| HM:PFM:NREP 1 HM:PFM:REP 48->336|PF05343|5.8e-93|37.1|283/292|Peptidase_M42| RP:SCP:NREP 3 RP:SCP:REP 20->90|2i09A2|4e-19|15.5|71/96|d.327.1.1| RP:SCP:REP 73->185|2greA1|2e-25|71.3|94/94|b.49.3.1| RP:SCP:REP 166->343|1yloA2|6e-26|19.0|174/264|c.56.5.4| HM:SCP:REP 5->343|1vhoA2|6.8e-54|34.7|239/0|c.56.5.4|1/1|Zn-dependent exopeptidases| OP:NHOMO 404 OP:NHOMOORG 264 OP:PATTERN 111-11----------11111111--------111111---11111---111113322343---1--- --1------------11--------1------------------1---------------11----------------1-1-1-------------1------------1---------------1--------11-11-----11------1--11------1---111-------------211--111123333333333333333323333333222242233333321322222222222222322331----1----------1----1-1--1111---2--11111111111-------------211---1111-21221111111111221111111-1111-1--22-----1--353--1------------------------------------1---1--1----1-----------11-------1---------------------11-------------------------------------------------------------------------------------------------------1---------------------1------------------------------------------------------------------------1------------------------1-----1---111--------1---------1---------------1-----------------------------1111--1---------------------------1-11111111111111111----------------------------------------1---------------2-21-1---1--12--111----121113123412111--1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 338 STR:RPRED 97.7 SQ:SECSTR #####HcHHHHHHHHHccccTTccHHHHHHHHHTTTTcTcccEEcccccEEEccccccccccccEEEEcccEcEEEEEEcTTccEEEEEEccccGGGTTTcEEEEEccccEEEEEcEEEcccccccccccccccccHHTTccccccccccHHHHHTTccTTcEEEEccccEEccccEEEcTTHHHHHHcHHHHHHHHHHHHHHccGGGccccccEEEEEcccTTTcHHHHHHTTccEEEccEEEccccccTTccTTcccEEEEEcccccccHHHHHHHHHHHHTTTcccEEEEcccccGGGGTTTcccEEEEEEEEEcTTTTcEEEHHHHHHHHTTccTTTTT### DISOP:02AL 1-3, 128-133| PSIPRED cccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccEEEEEcccEEEEEEccccccccEEEEEccccEEEEEEEEccccEEEEEEEccccHHHHcccEEEEEEccccEEEEEEEEccccccccccccccccccccEEEEEEcccccHHHHHHHccccccEEEEcccEEEEcccEEEEEccccHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccccccccccHHHHHHHHcccccccccccccccEEEEEEccccccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHcccccEEEEEEccccccccEEEEcHHHHHHHHHHHHHHHHcccc //