[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhfF
DDBJ      :yhfF         conserved hypothetical protein
Swiss-Prot:YHFF_BACSU   RecName: Full=Uncharacterized protein yhfF;

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.122.1
:135 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->133 1t62A PDBj 2e-07 25.2 %
:RPS:SCOP  4->134 1t62A  b.122.1.4 * 2e-13 21.6 %
:HMM:SCOP  9->134 1t62A_ b.122.1.4 * 4e-33 31.7 %
:HMM:PFM   18->125 PF04266 * ASCH 1.6e-08 21.7 92/104  
:BLT:SWISS 1->135 YHFF_BACSU 1e-76 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12861.1 GT:GENE yhfF GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1096116..1096523 GB:FROM 1096116 GB:TO 1096523 GB:DIRECTION + GB:GENE yhfF GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB12861.1 GB:DB_XREF SubtiList:BG13052 UniProtKB/Swiss-Prot:O07604 GB:GENE:GENE yhfF LENGTH 135 SQ:AASEQ MKIYKLKSTFGWEGDDGLGEQLIQQILAGEKSATCAPKSLYSKDELRDVYQTAGQLVTVYDKHDNPRCNIKVTDVFETTFGAPDMRLVKGEGNGDRIEEFQEDHRMAWAELIKSGELELNEDTVLITELFVLVKD GT:EXON 1|1-135:0| SW:ID YHFF_BACSU SW:DE RecName: Full=Uncharacterized protein yhfF; SW:GN Name=yhfF; OrderedLocusNames=BSU10210; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->135|YHFF_BACSU|1e-76|100.0|135/100| BL:PDB:NREP 1 BL:PDB:REP 13->133|1t62A|2e-07|25.2|115/153| HM:PFM:NREP 1 HM:PFM:REP 18->125|PF04266|1.6e-08|21.7|92/104|ASCH| RP:SCP:NREP 1 RP:SCP:REP 4->134|1t62A|2e-13|21.6|125/153|b.122.1.4| HM:SCP:REP 9->134|1t62A_|4e-33|31.7|123/166|b.122.1.4|1/1|PUA domain-like| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 117 STR:RPRED 86.7 SQ:SECSTR ############cccHHHHHHHHHHHHHTcccEEEEEcTTccTTT##cccccTTcEEEEEcTTccEEEEEEEEEEEEEEGGGccHHHHHHHcc##ccTHHHHHHHHHHHHHHTTTTccccTTcEEEEEEEEEE## DISOP:02AL 1-3| PSIPRED ccEEEcEEEEcccccHHHHHHHHHHHHcccccEEHHHHHHHHHHcccccccccccEEEEEcccccEEEEEEEEEEEEEEcccccHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEEcc //