[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhfH
DDBJ      :yhfH         hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:46 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   15->41 PF00130 * C1_1 6e-05 26.9 26/53  
:BLT:SWISS 1->46 YHFH_BACSU 3e-25 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12863.1 GT:GENE yhfH GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1098120..1098260) GB:FROM 1098120 GB:TO 1098260 GB:DIRECTION - GB:GENE yhfH GB:PRODUCT hypothetical protein GB:NOTE Evidence 6: Doubtful CDS GB:PROTEIN_ID CAB12863.1 GB:DB_XREF SubtiList:BG13053 UniProtKB/Swiss-Prot:O07606 GB:GENE:GENE yhfH LENGTH 46 SQ:AASEQ MVMLGKITEFFRNLPSKKCAECGKKIEEQHECYGNICNDCIKVNDL GT:EXON 1|1-46:0| BL:SWS:NREP 1 BL:SWS:REP 1->46|YHFH_BACSU|3e-25|100.0|46/100| HM:PFM:NREP 1 HM:PFM:REP 15->41|PF00130|6e-05|26.9|26/53|C1_1| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1111--11111-----11--111-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccHHHHHHHccccccHHHHHHHHHHHHHHHccHHHHHHHcccc //