[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhfJ
DDBJ      :yhfJ         putative lipoate-protein ligase
Swiss-Prot:LPLA_BACSU   RecName: Full=Putative lipoate-protein ligase A;         Short=Lipoate--protein ligase;         EC=2.7.7.63;

Homologs  Archaea  30/68 : Bacteria  345/915 : Eukaryota  145/199 : Viruses  0/175   --->[See Alignment]
d.104.1d.224.1
:331 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->330 1vqzA PDBj 7e-87 47.8 %
:RPS:PDB   1->244 2artA PDBj 2e-52 32.0 %
:RPS:SCOP  3->244 1vqzA2  d.104.1.3 * 9e-90 51.9 %
:RPS:SCOP  245->331 1vqzA1  d.224.1.3 * 7e-32 33.3 %
:HMM:SCOP  2->244 1vqzA2 d.104.1.3 * 1.6e-79 43.6 %
:HMM:SCOP  245->332 1vqzA1 d.224.1.3 * 1.4e-29 48.9 %
:RPS:PFM   54->134 PF03099 * BPL_LplA_LipB 4e-04 35.8 %
:RPS:PFM   245->330 PF10437 * Lip_prot_lig_C 3e-22 48.8 %
:HMM:PFM   245->330 PF10437 * Lip_prot_lig_C 2.2e-34 46.5 86/86  
:HMM:PFM   44->153 PF03099 * BPL_LplA_LipB 5.5e-27 33.3 108/125  
:BLT:SWISS 1->331 LPLA_BACSU 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12865.1 GT:GENE yhfJ GT:PRODUCT putative lipoate-protein ligase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1099159..1100154 GB:FROM 1099159 GB:TO 1100154 GB:DIRECTION + GB:GENE yhfJ GB:PRODUCT putative lipoate-protein ligase GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB12865.1 GB:DB_XREF GOA:O07608 InterPro:IPR005107 SubtiList:BG13055 UniProtKB/TrEMBL:O07608 GB:GENE:GENE yhfJ LENGTH 331 SQ:AASEQ MLFIDNQNINDPRINLAIEEYCVKHLDPEQQYLLFYVNQPSIIIGKNQNTIEEINTKYVEENGIIVVRRLSGGGAVYHDLGNLNFSFITKDDGDSFHNFKKFTEPVIQALHQLGVEAELSGRNDIVVDGRKISGNAQFATKGRIFSHGTLMFDSAIDHVVSALKVKKDKIESKGIKSIRSRVANISEFLDDKMTTEEFRSHLLRHIFNTNDVGNVPEYKLTEKDWETIHQISKERYQNWDWNYGRSPKFNLNHSKRYPVGSIDLHLEVKKGKIEDCKIFGDFFGVGDVSEIENLLVGKQYERSVIADVLEGVNLKHYFGNITKEDFLDLIY GT:EXON 1|1-331:0| SW:ID LPLA_BACSU SW:DE RecName: Full=Putative lipoate-protein ligase A; Short=Lipoate--protein ligase; EC=2.7.7.63; SW:GN Name=lplA; Synonyms=yhfJ; OrderedLocusNames=BSU10250; SW:KW ATP-binding; Complete proteome; Cytoplasm; Ligase; Nucleotide-binding;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->331|LPLA_BACSU|0.0|100.0|331/331| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 10->330|1vqzA|7e-87|47.8|316/326| RP:PDB:NREP 1 RP:PDB:REP 1->244|2artA|2e-52|32.0|231/247| RP:PFM:NREP 2 RP:PFM:REP 54->134|PF03099|4e-04|35.8|81/118|BPL_LplA_LipB| RP:PFM:REP 245->330|PF10437|3e-22|48.8|86/86|Lip_prot_lig_C| HM:PFM:NREP 2 HM:PFM:REP 245->330|PF10437|2.2e-34|46.5|86/86|Lip_prot_lig_C| HM:PFM:REP 44->153|PF03099|5.5e-27|33.3|108/125|BPL_LplA_LipB| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF03099|IPR004143| GO:PFM GO:0006464|"GO:protein modification process"|PF03099|IPR004143| RP:SCP:NREP 2 RP:SCP:REP 3->244|1vqzA2|9e-90|51.9|239/241|d.104.1.3| RP:SCP:REP 245->331|1vqzA1|7e-32|33.3|87/88|d.224.1.3| HM:SCP:REP 2->244|1vqzA2|1.6e-79|43.6|241/0|d.104.1.3|1/1|Class II aaRS and biotin synthetases| HM:SCP:REP 245->332|1vqzA1|1.4e-29|48.9|88/0|d.224.1.3|1/1|SufE/NifU| OP:NHOMO 688 OP:NHOMOORG 520 OP:PATTERN 221-112444444343--------1121---1----------------------1111111-111--- -----1-1111-2-------------------------------1---111-111111--------1-11-1111111---1112---111--1--1--1--------1-1-------------11----1---1----11----2----------------------------------------------12222222222222222222222222211221122222211233333333333332222222-3-11-3---221111111112111222211111111111-1111122222222222221111111111-11--2222222121-311----11--11----11---111-1111-1-1--1----------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------1-1-211-11-----11-1--1-1---------------------------------1111-----1----------------------------1------111-11-1111111111-1111111111111111111111-1--111111111111111111111---1--11111111111111---------------1---1-1-----------------11-------------------111111111----211111-----------------------111111--------2-211111-3-22111222121121-----111---1---- 11--111-211-111-1111111111111-1--11111-1111111--111111111-11111111111111111111111111111--1111-111-11111111-121111111-111--1-11-1-745-11111-11111--11-11--111112221111111112-11-1-------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 330 STR:RPRED 99.7 SQ:SECSTR EEEEccccTTcHHHHHHHHHHHHHHccTcccEEEEEccccEEEEcTTccHHHHccTTHHHHHTcEEEEcccccccEEEcTTEEEEEEEEEccccHHHHHHHHHHHHHHHHHHTTcccEEcccccTTcccccTTcEEEEEETTEEEEEEEEEccccHHHHHHHccccccccGHHHccccTTTcccGGGTccccccHHHHHHHHHHHHHHHHTccEEEEEcccHHHHHHHHHHHHHTTTcHHHHHTTcccEEEEEEEEEEccEEEEEEEEETTEEEEEEEcTTTccHHHHHHHHHHHTTcccccHHcTTTccHHHHHHHcTTHHHHHHHTTc# DISOP:02AL 170-174| PSIPRED cEEEEccccccHHHHHHHHHHHHHHccccccEEEEEEEccEEEEcccccHHHHHHHHHHHHccccEEEEcccccEEEEccccEEEEEEEccccccHHHHHHHHHHHHHHHHHcccEEEEEccccEEEccEEEEEEEEEEEccEEEEEEEEEEEccHHHHHHHHccccccHHHccccccHHHHccHHHHccccccHHHHHHHHHHHHHHHHccccccccEEcHHHHHHHHHHHHHHHccccccccccccEEEEEEEEccccEEEEEEEEEccEEEEEEEEcccccHHHHHHHHHHHccccccHHHHHHHHHHccccHHHccccHHHHHHHHc //