[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhfM
DDBJ      :yhfM         hypothetical protein
Swiss-Prot:YHFM_BACSU   RecName: Full=Uncharacterized protein yhfM;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:131 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->87 PF05144 * Phage_CRI 0.00017 23.9 71/271  
:BLT:SWISS 1->131 YHFM_BACSU 7e-72 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12868.1 GT:GENE yhfM GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1102560..1102955) GB:FROM 1102560 GB:TO 1102955 GB:DIRECTION - GB:GENE yhfM GB:PRODUCT hypothetical protein GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB12868.1 GB:DB_XREF SubtiList:BG13058 UniProtKB/Swiss-Prot:O07611 GB:GENE:GENE yhfM LENGTH 131 SQ:AASEQ MKKIVAAIVVIGLVFIAFFYLYSRSGDVYQSVDADLITLSSSGQEDIEIEKRQHVKDMLDIMNQGKQVKTEKTSAPDYEGTIKFHKDRYDSFRLWIDGSQQAVFLKDGTYYKLSKNDTKALLNIIKKEAKD GT:EXON 1|1-131:0| SW:ID YHFM_BACSU SW:DE RecName: Full=Uncharacterized protein yhfM;Flags: Precursor; SW:GN Name=yhfM; OrderedLocusNames=BSU10280; SW:KW Complete proteome; Signal. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->131|YHFM_BACSU|7e-72|100.0|131/100| TM:NTM 1 TM:REGION 4->26| HM:PFM:NREP 1 HM:PFM:REP 17->87|PF05144|0.00017|23.9|71/271|Phage_CRI| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 66-75, 128-131| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEccccccEEEHHHHHHHHHHHHHHcccEEccccccccccEEEEEEEEEEEEEEEEEEEccccEEEEEcccEEEEEcccHHHHHHHHHHHHcc //