[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhjH
DDBJ      :yhjH         putative transcriptional regulator
Swiss-Prot:YHJH_BACSU   RecName: Full=Uncharacterized HTH-type transcriptional regulator yhjH;

Homologs  Archaea  4/68 : Bacteria  73/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:175 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   27->155 3bpxB PDBj 8e-13 23.7 %
:RPS:SCOP  47->153 2ethA1  a.4.5.28 * 7e-13 23.1 %
:HMM:SCOP  10->161 1jgsA_ a.4.5.28 * 3.2e-21 24.8 %
:HMM:PFM   49->107 PF01047 * MarR 6.1e-20 27.1 59/59  
:HMM:PFM   80->140 PF04229 * UPF0157 0.00063 18.0 61/167  
:BLT:SWISS 1->175 YHJH_BACSU e-100 100.0 %
:PROS 81->115|PS01117|HTH_MARR_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12891.1 GT:GENE yhjH GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1124438..1124965 GB:FROM 1124438 GB:TO 1124965 GB:DIRECTION + GB:GENE yhjH GB:PRODUCT putative transcriptional regulator GB:FUNCTION 16.3: Control GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pr: putative regulator GB:PROTEIN_ID CAB12891.1 GB:DB_XREF GOA:Q796S4 InterPro:IPR011991 SubtiList:BG13074 UniProtKB/Swiss-Prot:Q796S4 GB:GENE:GENE yhjH LENGTH 175 SQ:AASEQ MNTDHTKRNLFELYAELIHQQEKWEGLIKAFLSDELRKLDVEHGSKSQLTMTEIHVLSCVGDNEPINVTSIAEKMNTTKATVSRISTKLLGAGFLHRTQLSDNKKEVYFRLTPAGKKLHSLHKYYHQKAEQRFLSFFDRYTEEEILFAERLFRDLVTKWYPSSEEIEGGLPSIFK GT:EXON 1|1-175:0| SW:ID YHJH_BACSU SW:DE RecName: Full=Uncharacterized HTH-type transcriptional regulator yhjH; SW:GN Name=yhjH; OrderedLocusNames=BSU10510; SW:KW Complete proteome; Cytoplasm; DNA-binding; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->175|YHJH_BACSU|e-100|100.0|175/175| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| PROS 81->115|PS01117|HTH_MARR_1|PDOC00861| RP:PDB:NREP 1 RP:PDB:REP 27->155|3bpxB|8e-13|23.7|118/138| HM:PFM:NREP 2 HM:PFM:REP 49->107|PF01047|6.1e-20|27.1|59/59|MarR| HM:PFM:REP 80->140|PF04229|0.00063|18.0|61/167|UPF0157| RP:SCP:NREP 1 RP:SCP:REP 47->153|2ethA1|7e-13|23.1|104/140|a.4.5.28| HM:SCP:REP 10->161|1jgsA_|3.2e-21|24.8|137/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 113 OP:NHOMOORG 77 OP:PATTERN -------------------------------------------11--1--1----------------- --------------1----------1-----------------------------------------------------1-----------------------------------------------------------------------------------------------------------------21111122121112212-3313111---1---11111122------1-11---111--12-------------------11-21----------11-------------------------------------142223333-21--22--1-11--------221-------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------1------1-----------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 175 STR:RPRED 100.0 SQ:SECSTR ccccTTcccHHHHTTcHHHHHHHHHHHHHHHHHHHHGGGTHHTTHHHTccHHHHHHHHHHHHcTTccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHTTHTTTccHHHHHHHHHHHHHHHHccccTTcEEEccHHHHHH DISOP:02AL 1-5, 171-175| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccccc //