[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhzB
DDBJ      :yhzB         conserved hypothetical protein
Swiss-Prot:YHZB_BACSU   RecName: Full=Uncharacterized protein yhzB;

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.153.1
:207 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   95->194 1b70B PDBj 2e-08 18.2 %
:HMM:SCOP  46->206 1pysB6 b.153.1.1 * 2.4e-08 14.4 %
:HMM:PFM   95->141 PF03483 * B3_4 0.0003 14.9 47/174  
:BLT:SWISS 1->207 YHZB_BACSU e-118 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12718.1 GT:GENE yhzB GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(967229..967852) GB:FROM 967229 GB:TO 967852 GB:DIRECTION - GB:GENE yhzB GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB12718.1 GB:DB_XREF GOA:O31588 SubtiList:BG13086 UniProtKB/Swiss-Prot:O31588 GB:GENE:GENE yhzB LENGTH 207 SQ:AASEQ MNIKLDSVITERAAGLHAAAVIYENIEVGSSPQMLKGRLRLFQESLFFDYADGGISDESFVKEWQKLFKQLNPSFEGETTPMEDMLVPISKEQFMESKDSAHDTIDFFALKYSLPIMIYDAGKLHEPVRISLGEKENILLFSDENGIFGDFKNSVNHYPVSNETKNMLQIIFFPPSIEKSSAVNLLSSLTKMFEQIHGGTHTVHWLT GT:EXON 1|1-207:0| SW:ID YHZB_BACSU SW:DE RecName: Full=Uncharacterized protein yhzB; SW:GN Name=yhzB; OrderedLocusNames=BSU08900; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->207|YHZB_BACSU|e-118|100.0|207/207| RP:PDB:NREP 1 RP:PDB:REP 95->194|1b70B|2e-08|18.2|99/775| HM:PFM:NREP 1 HM:PFM:REP 95->141|PF03483|0.0003|14.9|47/174|B3_4| HM:SCP:REP 46->206|1pysB6|2.4e-08|14.4|160/209|b.153.1.1|1/1|PheT/TilS domain| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------111111---1111---------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 47.8 SQ:SECSTR ##############################################################################################cccccHHHHHHHHHHHHccccEEEEEGGGTcTEEEEEEccTTTcEEEEEEETTEEETEEc#TTTcccTTccEEEEEEccHHHHHHHHHTTcccHHHHHHH############# PSIPRED cEEEEcHHHHHHccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHcccccHHHcHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccEEEHHHccccEEEEEEccccEEEEEccccccccEEEcccEEEEcccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEc //