[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yisX
DDBJ      :yisX         conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  76/915 : Eukaryota  36/199 : Viruses  0/175   --->[See Alignment]
b.80.8
:212 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   29->211 2w7zB PDBj 8e-19 29.9 %
:RPS:PDB   35->209 2bm7C PDBj 1e-26 20.0 %
:RPS:SCOP  35->208 2bm4A1  b.80.8.1 * 2e-23 20.1 %
:HMM:SCOP  33->213 2bm5A1 b.80.8.1 * 1.6e-41 22.7 %
:HMM:PFM   64->100 PF00805 * Pentapeptide 3.4e-08 21.6 37/40  
:HMM:PFM   143->182 PF00805 * Pentapeptide 7.6e-10 25.0 40/40  
:BLT:SWISS 42->192 KCTD9_HUMAN 9e-11 26.0 %
:REPEAT 2|64->118|124->178

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12929.1 GT:GENE yisX GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1168199..1168837) GB:FROM 1168199 GB:TO 1168837 GB:DIRECTION - GB:GENE yisX GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB12929.1 GB:DB_XREF InterPro:IPR001646 SubtiList:BG13103 UniProtKB/TrEMBL:O06733 GB:GENE:GENE yisX LENGTH 212 SQ:AASEQ MNKIAIQKPNIPENLQTADFHDAVTQDDVISMHLFEDCTICGEDIERLCVEKTVFRNVVFIDVSFRHIELTDVIFEKCDLSNADFSGAVIHRTSVKQSKMVGMNVAEATLRNVSFEECHGHFSSFSYSNMKQVRFDHCALMQSECSDTVLQQTHFDGCELEGASFTGTSLQNMDISTCRFEQLHVSLDKLKGCKIAPEHAIAFARALGAVIV GT:EXON 1|1-212:0| BL:SWS:NREP 1 BL:SWS:REP 42->192|KCTD9_HUMAN|9e-11|26.0|146/389| NREPEAT 1 REPEAT 2|64->118|124->178| BL:PDB:NREP 1 BL:PDB:REP 29->211|2w7zB|8e-19|29.9|177/202| RP:PDB:NREP 1 RP:PDB:REP 35->209|2bm7C|1e-26|20.0|175/180| HM:PFM:NREP 2 HM:PFM:REP 64->100|PF00805|3.4e-08|21.6|37/40|Pentapeptide| HM:PFM:REP 143->182|PF00805|7.6e-10|25.0|40/40|Pentapeptide| RP:SCP:NREP 1 RP:SCP:REP 35->208|2bm4A1|2e-23|20.1|174/180|b.80.8.1| HM:SCP:REP 33->213|2bm5A1|1.6e-41|22.7|181/0|b.80.8.1|1/1|Pentapeptide repeat-like| OP:NHOMO 127 OP:NHOMOORG 114 OP:PATTERN -------------------------------------------------1-2---------------- ------------------------------------------------------------11--1---------------1-------111--1-------2----21----------------------1-------------1------------------------------------------------1--2-11-1-11111111---11-----1111111111-1-------------------11-1--------11----1-1---111---------------------------------------------1121111111111111---11-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------1-----1-----------------1----------------------------------------11-------------------------------------1---------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------12112221---1-1-11-1-141-121--1-1-11111--11--1-1-111-111----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 204 STR:RPRED 96.2 SQ:SECSTR #######ccccccccTTcccTTcccTTcccTccEccccEEEccccTTcccTTcEEEccEEEccccTTcccTTcEEEccEEETcEEEccccTTEEEEEEEccccEEEccccccEEEEEEEcTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTccccHHHHHHcccTTccccHHHHHHHHHTTTccc# PSIPRED cccccccccccHHHHccccccccccccccHHcccccccEEcccccccccccccEEEccEEccccccccEEcccEEcccEEccccccccEEcccEEEccccccccccccEEcccEEcccEEcccEEEccccccccccccEEccccccccEEEccEEEccccccccccccEEccccccccEEEccEEcccEEcccEEcHHHHHHHHHHcccEEc //