[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yisZ
DDBJ      :yisZ         putative adenylylsulfate kinase
Swiss-Prot:CYSC2_BACSU  RecName: Full=Probable adenylyl-sulfate kinase;         EC=2.7.1.25;AltName: Full=APS kinase;AltName: Full=Adenosine-5'-phosphosulfate kinase;AltName: Full=ATP adenosine-5'-phosphosulfate 3'-phosphotransferase;

Homologs  Archaea  13/68 : Bacteria  480/915 : Eukaryota  178/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:199 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->199 2ofxA PDBj 1e-53 50.0 %
:RPS:PDB   10->199 2ax4A PDBj 3e-45 48.9 %
:RPS:SCOP  6->164 1b7tA4  c.37.1.9 * 2e-28 15.7 %
:HMM:SCOP  20->201 1x6vA3 c.37.1.4 * 5.2e-37 31.5 %
:RPS:PFM   26->180 PF01583 * APS_kinase 3e-65 67.1 %
:HMM:PFM   26->180 PF01583 * APS_kinase 3.6e-77 60.0 155/157  
:BLT:SWISS 1->199 CYSC2_BACSU e-116 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12931.1 GT:GENE yisZ GT:PRODUCT putative adenylylsulfate kinase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1169877..1170476) GB:FROM 1169877 GB:TO 1170476 GB:DIRECTION - GB:GENE yisZ GB:PRODUCT putative adenylylsulfate kinase GB:FUNCTION 16.5: Explore GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15383836; Product type pe : putative enzyme GB:PROTEIN_ID CAB12931.1 GB:DB_XREF GOA:O06735 HSSP:1M7G InterPro:IPR002891 SubtiList:BG13105 UniProtKB/Swiss-Prot:O06735 GB:GENE:GENE yisZ LENGTH 199 SQ:AASEQ MTHNPNIIWHPAAISKSDRQSLNGHKSCVLWFTGLSGSGKSVLANAVDEKLYRKGIQSYVLDGDNIRHGLNKDLGFQTGDRIENIRRIGEVAKLFVDSGQMILTAFISPFREDRDMVRALFPKGEFFEIYVKCPLHVCEQRDPKGLYKKARNGEIKHFTGIDSPYEAPLSPDFIIESDQTSISDGADLIINALQNRGII GT:EXON 1|1-199:0| SW:ID CYSC2_BACSU SW:DE RecName: Full=Probable adenylyl-sulfate kinase; EC=2.7.1.25;AltName: Full=APS kinase;AltName: Full=Adenosine-5'-phosphosulfate kinase;AltName: Full=ATP adenosine-5'-phosphosulfate 3'-phosphotransferase; SW:GN Name=yisZ; OrderedLocusNames=BSU10910; SW:KW ATP-binding; Complete proteome; Kinase; Nucleotide-binding;Phosphoprotein; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->199|CYSC2_BACSU|e-116|100.0|199/199| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 6->199|2ofxA|1e-53|50.0|194/205| RP:PDB:NREP 1 RP:PDB:REP 10->199|2ax4A|3e-45|48.9|190/198| RP:PFM:NREP 1 RP:PFM:REP 26->180|PF01583|3e-65|67.1|155/157|APS_kinase| HM:PFM:NREP 1 HM:PFM:REP 26->180|PF01583|3.6e-77|60.0|155/157|APS_kinase| GO:PFM:NREP 4 GO:PFM GO:0000103|"GO:sulfate assimilation"|PF01583|IPR002891| GO:PFM GO:0005524|"GO:ATP binding"|PF01583|IPR002891| GO:PFM GO:0016301|"GO:kinase activity"|PF01583|IPR002891| GO:PFM GO:0016772|"GO:transferase activity, transferring phosphorus-containing groups"|PF01583|IPR002891| RP:SCP:NREP 1 RP:SCP:REP 6->164|1b7tA4|2e-28|15.7|159/718|c.37.1.9| HM:SCP:REP 20->201|1x6vA3|5.2e-37|31.5|178/0|c.37.1.4|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 988 OP:NHOMOORG 671 OP:PATTERN 11-111-------------1-1-1------------------------1-----1----1------11 1-1-2---------22211-11--21111111122223221113---1------------111---12111-----------2111--1111-1-------1--121-1------------------1--121--312211---1-111111111111111111121--12111111111111111-----11111111111111111112111211111111--------11---------------11111-----------11----------------------------------------------------------1-1-------------22------1-----1---2-1-1-1---------121111-----111221111211211111111111-2-1--2-1111----2--1---221111111111111111111111111111111------------------------------11111------11221232331-12334333321121--2--2--1--1---1--1-1---1---------11----12211---21111--213--2-1112123-2---1-1-1211-1--------1--2222111111-11111111111111111121211--112-1--1111111-111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-111111----1121--------------------------4121113342211122231--1--11---11111111111111--111111211111--2---------------------------------------------11------11- ----111-------222222232122122222222222221122212222222222212222211111-11111111-1111111111-332222522222-2223--3-23423332221242232325F3-32712223223-22211222322222133211316115111111-1I1113153242431221214 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 199 STR:RPRED 100.0 SQ:SECSTR cccGGGcccccccccHHHHHHHcccccEEEEEEccTTccHHHHHHHHHHHHHHTTccEEEEcHHHHTTTTTTTccccHHHHHHHHHHHHHHHHHHHHTTcEEEEEcccccHHHHHHHHHHHHHTcEEEEEEEccHHHHHHHccccHHHHHHTTccccccTTTccccccccccEEEETTcccHHHHHHHHHHHHHHTTcc DISOP:02AL 1-2, 14-23| PSIPRED cccccccccccccccHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHcccccEEEEEEEccHHHHHHcccHHHHHHHHHccccccccccccccccccccEEEEcccccHHHHHHHHHHHHHHcccc //