[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yjbM
DDBJ      :yjbM         (p)ppGpp synthetase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  216/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.218.1
:211 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->201 2be3A PDBj 5e-53 56.0 %
:RPS:PDB   5->202 2be3A PDBj 1e-47 57.2 %
:RPS:SCOP  5->201 2be3A1  d.218.1.8 * 5e-65 57.4 %
:HMM:SCOP  2->198 2be3A1 d.218.1.8 * 4e-63 40.1 %
:RPS:PFM   45->160 PF04607 * RelA_SpoT 3e-18 47.7 %
:HMM:PFM   45->162 PF04607 * RelA_SpoT 8.6e-39 46.8 111/112  
:HMM:PFM   138->210 PF12128 * DUF3584 6.5e-05 23.5 68/1202  
:BLT:SWISS 1->194 YWAC_BACSU 5e-35 40.7 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13017.1 GT:GENE yjbM GT:PRODUCT (p)ppGpp synthetase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1237006..1237641 GB:FROM 1237006 GB:TO 1237641 GB:DIRECTION + GB:GENE yjbM GB:PRODUCT (p)ppGpp synthetase GB:FUNCTION 16.14: Store 16.3: Control GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 18067544; Product type e: enzyme GB:PROTEIN_ID CAB13017.1 GB:DB_XREF GOA:O31611 InterPro:IPR007685 SubtiList:BG13142 UniProtKB/TrEMBL:O31611 GB:GENE:GENE yjbM LENGTH 211 SQ:AASEQ MDDKQWERFLVPYRQAVEELKVKLKGIRTLYEYEDDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDQRDYIAEHKESGYRSYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQEAQAAFSRKKKGSEQQ GT:EXON 1|1-211:0| BL:SWS:NREP 1 BL:SWS:REP 1->194|YWAC_BACSU|5e-35|40.7|194/210| COIL:NAA 33 COIL:NSEG 1 COIL:REGION 170->202| BL:PDB:NREP 1 BL:PDB:REP 5->201|2be3A|5e-53|56.0|193/197| RP:PDB:NREP 1 RP:PDB:REP 5->202|2be3A|1e-47|57.2|194/197| RP:PFM:NREP 1 RP:PFM:REP 45->160|PF04607|3e-18|47.7|109/112|RelA_SpoT| HM:PFM:NREP 2 HM:PFM:REP 45->162|PF04607|8.6e-39|46.8|111/112|RelA_SpoT| HM:PFM:REP 138->210|PF12128|6.5e-05|23.5|68/1202|DUF3584| GO:PFM:NREP 1 GO:PFM GO:0015969|"GO:guanosine tetraphosphate metabolic process"|PF04607|IPR007685| RP:SCP:NREP 1 RP:SCP:REP 5->201|2be3A1|5e-65|57.4|197/203|d.218.1.8| HM:SCP:REP 2->198|2be3A1|4e-63|40.1|197/0|d.218.1.8|1/1|Nucleotidyltransferase| OP:NHOMO 319 OP:NHOMOORG 216 OP:PATTERN -------------------------------------------------------------------- --------1111---------1---1------1---1111-----11111-1----1-----2-1------1111111--11-----------------------------------------------------------------1-----------------------------------111------12222222222222222222222222111212322222222222222222222222222221212112221222121111211-22222211112221111111111122222222232222111111111-222211111112121111111121---1321-21-----------------------------------------------------------1----------------------1--------------------------------------------------------------------1--------------------------1---111-------------------------------------------1-1-----1-----------------------------------------------------------------------------------------------------------1------------------------1--------------------------------11111-----------------------------------1-------1------------------1------------11--------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 202 STR:RPRED 95.7 SQ:SECSTR HHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccEEEEEEEEccHHHHHHHHHHTccTTTHHHHcTTcEEEEEEEccGGGHHHHHHHHHTTcccEEEEEEETTTTccTTccccEEEEEEEEEccTTccEEEEEEEEEEEHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHcc######### DISOP:02AL 1-3, 197-211| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHccccHHHHHHHHHHHHHEEEEccHHHHHHHHHHHHcccccEEEEccccEEcccccccEEEEEEEEEcccccccccccEEEEEEcHHHHHHHHHHHHHEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //