[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yjcN
DDBJ      :yjcN         conserved hypothetical protein
Swiss-Prot:YJCN_BACSU   RecName: Full=Uncharacterized protein yjcN;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:106 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->81 PF11337 * DUF3139 0.00051 28.9 76/85  
:BLT:SWISS 1->106 YJCN_BACSU 9e-46 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13049.1 GT:GENE yjcN GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1265057..1265377 GB:FROM 1265057 GB:TO 1265377 GB:DIRECTION + GB:GENE yjcN GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13049.1 GB:DB_XREF SubtiList:BG13167 UniProtKB/Swiss-Prot:O31636 GB:GENE:GENE yjcN LENGTH 106 SQ:AASEQ MKKKTKIILSLLAALIVILIVLPVLSPVVFTASSEKGAIRHEIYKRGYPYQSYFAVLQKREGDNESGNLYYVNWLDWKDETGQTPHLCYSKKSSDGEYEVSCGTGP GT:EXON 1|1-106:0| SW:ID YJCN_BACSU SW:DE RecName: Full=Uncharacterized protein yjcN;Flags: Precursor; SW:GN Name=yjcN; OrderedLocusNames=BSU11920; SW:KW Complete proteome; Signal. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->106|YJCN_BACSU|9e-46|100.0|106/100| TM:NTM 1 TM:REGION 9->31| SEG 7->29|iilsllaalivilivlpvlspvv| HM:PFM:NREP 1 HM:PFM:REP 1->81|PF11337|0.00051|28.9|76/85|DUF3139| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1--------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 105-106| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHEEEccccccHHHHHHHHccccHHHHHHHHHHHccccccccEEEEEEEEEccccccccEEEEcccccccEEEEEEcccc //