[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yjcS
DDBJ      :yjcS         conserved hypothetical protein
Swiss-Prot:YJCS_BACSU   RecName: Full=Uncharacterized protein yjcS;

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:105 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->104 1q8bA PDBj 4e-46 100.0 %
:RPS:PDB   14->90 2bbeA PDBj 2e-06 16.9 %
:RPS:SCOP  12->104 1q8bA  d.58.4.6 * 7e-15 95.7 %
:HMM:SCOP  12->104 1q8bA_ d.58.4.6 * 9.2e-18 25.8 %
:HMM:PFM   25->88 PF03992 * ABM 3e-09 17.5 63/78  
:HMM:PFM   3->40 PF08678 * Rsbr_N 0.001 15.8 38/129  
:BLT:SWISS 1->105 YJCS_BACSU 4e-60 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13054.1 GT:GENE yjcS GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1268275..1268592 GB:FROM 1268275 GB:TO 1268592 GB:DIRECTION + GB:GENE yjcS GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13054.1 GB:DB_XREF PDB:1Q8B SubtiList:BG13172 UniProtKB/Swiss-Prot:O31641 GB:GENE:GENE yjcS LENGTH 105 SQ:AASEQ MKSHKMMGGGISMHYITACLKIISDKDLNEIMKEFKKLEEETNKEEGCITFHAYPLEPSERKIMLWEIWENEEAVKIHFTKKHTIDVQKQELTEVEWLMKSNVND GT:EXON 1|1-105:0| SW:ID YJCS_BACSU SW:DE RecName: Full=Uncharacterized protein yjcS; SW:GN Name=yjcS; OrderedLocusNames=BSU11970; SW:KW 3D-structure; Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->105|YJCS_BACSU|4e-60|100.0|105/105| BL:PDB:NREP 1 BL:PDB:REP 14->104|1q8bA|4e-46|100.0|88/89| RP:PDB:NREP 1 RP:PDB:REP 14->90|2bbeA|2e-06|16.9|77/103| HM:PFM:NREP 2 HM:PFM:REP 25->88|PF03992|3e-09|17.5|63/78|ABM| HM:PFM:REP 3->40|PF08678|0.001|15.8|38/129|Rsbr_N| RP:SCP:NREP 1 RP:SCP:REP 12->104|1q8bA|7e-15|95.7|93/93|d.58.4.6| HM:SCP:REP 12->104|1q8bA_|9.2e-18|25.8|93/0|d.58.4.6|1/1|Dimeric alpha+beta barrel| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------11-1-----------1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 94.3 SQ:SECSTR ##TTGGGccc##cccEEEEEEEEcTTcHHHHHHHHHTTHHHHHTcTTEEEEEEEEccccTTEEEEEEEEccHHHHHHHHTcHHHHHHHHHTcEEEEEE#EEEEc# DISOP:02AL 1-8, 104-105| PSIPRED cccccccccccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHccccccEEEEEEccccccccEEEEEEEccHHHHHHHcccHHHHHHHHccccHHHHHHHccccc //