[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yjdG
DDBJ      :yjdG         putative acetyltransferase
Swiss-Prot:YJDG_BACSU   RecName: Full=Uncharacterized N-acetyltransferase yjdG;         EC=2.3.1.-;

Homologs  Archaea  0/68 : Bacteria  64/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:168 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   54->150 3fbuA PDBj 2e-07 34.4 %
:RPS:PDB   22->160 3eg7C PDBj 1e-11 13.8 %
:RPS:SCOP  4->151 2fckA1  d.108.1.1 * 2e-18 18.7 %
:HMM:SCOP  1->153 2fckA1 d.108.1.1 * 1e-23 30.5 %
:HMM:PFM   75->151 PF00583 * Acetyltransf_1 4.9e-13 25.0 76/83  
:BLT:SWISS 1->168 YJDG_BACSU 2e-98 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13061.1 GT:GENE yjdG GT:PRODUCT putative acetyltransferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1276337..1276843) GB:FROM 1276337 GB:TO 1276843 GB:DIRECTION - GB:GENE yjdG GB:PRODUCT putative acetyltransferase GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB13061.1 GB:DB_XREF GOA:O31648 InterPro:IPR000182 SubtiList:BG13179 UniProtKB/Swiss-Prot:O31648 GB:GENE:GENE yjdG LENGTH 168 SQ:AASEQ MVLLETNRLRLQTIDIPLLDAASKQDHQAIKELGYETNGEWPNSDFFEAIPYFREILVKNNGTKGFDSWIIVKKDNYEIVGGTGFLGDPDENGMIEIGFATNKSHRRKGYCVEAAQKLINWALSRETVSRITARCEHDNLGSQKTLEKLGFILNHKSAEYKHWIYVTK GT:EXON 1|1-168:0| SW:ID YJDG_BACSU SW:DE RecName: Full=Uncharacterized N-acetyltransferase yjdG; EC=2.3.1.-; SW:GN Name=yjdG; OrderedLocusNames=BSU12040; SW:KW Acyltransferase; Complete proteome; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->168|YJDG_BACSU|2e-98|100.0|168/168| GO:SWS:NREP 2 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 54->150|3fbuA|2e-07|34.4|93/166| RP:PDB:NREP 1 RP:PDB:REP 22->160|3eg7C|1e-11|13.8|138/167| HM:PFM:NREP 1 HM:PFM:REP 75->151|PF00583|4.9e-13|25.0|76/83|Acetyltransf_1| RP:SCP:NREP 1 RP:SCP:REP 4->151|2fckA1|2e-18|18.7|139/174|d.108.1.1| HM:SCP:REP 1->153|2fckA1|1e-23|30.5|151/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 71 OP:NHOMOORG 64 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------11-----------------------1-----------2-1---------------------------------111--------1-----------------1-----------------------11111321-111211--11-1111---1---1111111-------------------------------------------------------------111---1--------------------------2-111---111----------------1------------1-1---------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------1------1--1-------------------------------------------------------------------------------------------------------------111--------------------11-11------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 159 STR:RPRED 94.6 SQ:SECSTR #######EEEEEccccccccHccGGGHHHHHHTTTTcccEEETTEEEccHHHHHHHHHHTTTccTTcEEEEEEcTTccEEEEEEEEEEETTTTEEEEEEEEcGGGTTcccHHHHHHHHHHHHHHTccccEEEEEEETTcHHHHHHHHHTTcEEEEEEEEEHTcccc## PSIPRED ccEEEcccEEEEcccHHHccHHHHccHHHHHHcccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEEEcccccEEEEEEEEEccccccEEEEEEEEcHHHHcccHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHcccEEEEEEEEEEEEEEEEc //