[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yjgD
DDBJ      :yjgD         conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:186 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   121->155 PF07849 * DUF1641 2e-04 37.1 %
:HMM:PFM   115->155 PF07849 * DUF1641 4.7e-17 34.1 41/42  
:HMM:PFM   13->116 PF07688 * KaiA 0.00066 25.2 103/283  
:BLT:SWISS 32->159 YRHD_BACSU 1e-09 20.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13074.1 GT:GENE yjgD GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1288541..1289101 GB:FROM 1288541 GB:TO 1289101 GB:DIRECTION + GB:GENE yjgD GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13074.1 GB:DB_XREF InterPro:IPR012440 SubtiList:BG13191 UniProtKB/TrEMBL:O34681 GB:GENE:GENE yjgD LENGTH 186 SQ:AASEQ MAKAIKRIQKIEVTEEDQRKRDLREIEDALIDHKEAILETLHMLGHMNERGVLPLLRGLFGQGDKVLDILVKKADTEETANTLKNLLLLFGTLGMLDVKQLEPLILKVNAGVASAVEQKNSEEKTGYFDIIRSLKDPEINKSITLLFSFLKGMGQDTKELERTTQPPEHQKHHQEPREKRGMNKRD GT:EXON 1|1-186:0| BL:SWS:NREP 1 BL:SWS:REP 32->159|YRHD_BACSU|1e-09|20.3|128/160| SEG 81->96|ntlknllllfgtlgml| RP:PFM:NREP 1 RP:PFM:REP 121->155|PF07849|2e-04|37.1|35/41|DUF1641| HM:PFM:NREP 2 HM:PFM:REP 115->155|PF07849|4.7e-17|34.1|41/42|DUF1641| HM:PFM:REP 13->116|PF07688|0.00066|25.2|103/283|KaiA| OP:NHOMO 43 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11111122212222221-22-1221-111-----------1--------------1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 161-186| PSIPRED ccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccc //