[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yjiC
DDBJ      :yjiC         putative glycosyltransferase
Swiss-Prot:YJIC_BACSU   RecName: Full=Uncharacterized UDP-glucosyltransferase yjiC;         EC=2.4.1.-;

Homologs  Archaea  4/68 : Bacteria  93/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
c.87.1
:392 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->361 2iyaA PDBj 2e-76 40.3 %
:RPS:PDB   2->366 3d0rB PDBj 8e-35 14.6 %
:RPS:SCOP  5->348 1iirA  c.87.1.5 * 2e-35 22.8 %
:HMM:SCOP  1->387 1iirA_ c.87.1.5 * 5e-76 30.9 %
:RPS:PFM   15->124 PF03033 * Glyco_transf_28 8e-05 30.8 %
:RPS:PFM   213->369 PF00201 * UDPGT 1e-15 31.0 %
:HMM:PFM   220->355 PF00201 * UDPGT 2.1e-16 27.3 132/501  
:HMM:PFM   11->104 PF03033 * Glyco_transf_28 2.1e-09 26.1 88/139  
:BLT:SWISS 1->392 YJIC_BACSU 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13079.1 GT:GENE yjiC GT:PRODUCT putative glycosyltransferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1292557..1293735 GB:FROM 1292557 GB:TO 1293735 GB:DIRECTION + GB:GENE yjiC GB:PRODUCT putative glycosyltransferase GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB13079.1 GB:DB_XREF GOA:O34539 InterPro:IPR006326 SubtiList:BG13196 UniProtKB/Swiss-Prot:O34539 GB:GENE:GENE yjiC LENGTH 392 SQ:AASEQ MKKYHISMINIPAYGHVNPTLALVEKLCEKGHRVTYATTEEFAPAVQQAGGEALIYHTSLNIDPKQIREMMEKNDAPLSLLKESLSILPQLEELYKDDQPDLIIYDFVALAGKLFAEKLNVPVIKLCSSYAQNESFQLGNEDMLKKIREAEAEFKAYLEQEKLPAVSFEQLAVPEALNIVFMPKSFQIQHETFDDRFCFVGPSLGERKEKESLLIDKDDRPLMLISLGTAFNAWPEFYKMCIKAFRDSSWQVIMSVGKTIDPESLEDIPANFTIRQSVPQLEVLEKADLFISHGGMNSTMEAMNAGVPLVVIPQMYEQELTANRVDELGLGVYLPKEEVTVSSLQEAVQAVSSDQELLSRVKNMQKDVKEAGGAERAAAEIEAFMKKSAVPQ GT:EXON 1|1-392:0| SW:ID YJIC_BACSU SW:DE RecName: Full=Uncharacterized UDP-glucosyltransferase yjiC; EC=2.4.1.-; SW:GN Name=yjiC; OrderedLocusNames=BSU12220; SW:KW Complete proteome; Glycosyltransferase; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->392|YJIC_BACSU|0.0|100.0|392/392| GO:SWS:NREP 2 GO:SWS GO:0016757|"GO:transferase activity, transferring glycosyl groups"|Glycosyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 370->383|eaggaeraaaeiea| BL:PDB:NREP 1 BL:PDB:REP 5->361|2iyaA|2e-76|40.3|352/392| RP:PDB:NREP 1 RP:PDB:REP 2->366|3d0rB|8e-35|14.6|356/381| RP:PFM:NREP 2 RP:PFM:REP 15->124|PF03033|8e-05|30.8|104/138|Glyco_transf_28| RP:PFM:REP 213->369|PF00201|1e-15|31.0|155/278|UDPGT| HM:PFM:NREP 2 HM:PFM:REP 220->355|PF00201|2.1e-16|27.3|132/501|UDPGT| HM:PFM:REP 11->104|PF03033|2.1e-09|26.1|88/139|Glyco_transf_28| GO:PFM:NREP 5 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF03033|IPR004276| GO:PFM GO:0016758|"GO:transferase activity, transferring hexosyl groups"|PF03033|IPR004276| GO:PFM GO:0030259|"GO:lipid glycosylation"|PF03033|IPR004276| GO:PFM GO:0008152|"GO:metabolic process"|PF00201|IPR002213| GO:PFM GO:0016758|"GO:transferase activity, transferring hexosyl groups"|PF00201|IPR002213| RP:SCP:NREP 1 RP:SCP:REP 5->348|1iirA|2e-35|22.8|320/382|c.87.1.5| HM:SCP:REP 1->387|1iirA_|5e-76|30.9|376/0|c.87.1.5|1/1|UDP-Glycosyltransferase/glycogen phosphorylase| OP:NHOMO 235 OP:NHOMOORG 119 OP:PATTERN -------------------------------------------------1111--------------- -12-1----------------1--13--------1--111-3---11--11------2--4---526122-----------1-----------------------3-1------------------------------------41--11--1-----------1----11----------------------32222234222233431-3313223---1---------1--------------------1----------------------------------11-------------------------------------42111111----42--------2---------------------------1---------1--------------------------------2--------1------1----------------------------------------------------------------------111111--------------1------------------------------------------------------------------------2------------------------------1--------------------------------------------------11--------1-----------------------32------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ -----------------------------------------------1---------------------------------------------1-------1------5-7-----------------------------21---1----1-------3----3-6533264412----------------1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 369 STR:RPRED 94.1 SQ:SECSTR ccccEEEEEccccTTccGGGHHHHHHHHHTTcEEEEEEcccHHHHHHTTTccEEEccTTccHHHHHHHHHHHcTTcTTTGGGcccccGGGGHHHHHHHcccEHHHHHHHHHHHHHHHHcccEEEEETTcHHHHHHHHHHTccEEEEcccccccTTHHHHHHTTcHHHHHHHTcccccccEEEcccGGGcccccTTEEEcccccccccccccccccccccccEEEEEccHHHHHHGGGGHHHHHHHTTccccEEEEcTTcGccGGGccccTTEEEcccccHHHHHTTEEEEEEcccTTHHHHHHHHTccEEEcccTTccccHHHHHHHHHHTcEEEEEccGGGccHHHHHHHHHcHHHHHHHHHHHHHHH####################### DISOP:02AL 361-374, 391-392| PSIPRED ccccEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHccccEEEEcccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHcccccEEEEEccHHHcccHHHccccEEEEccccccccccHHHHHccccccEEEEEccccccccHHHHHHHHHHHHHcccEEEEEEccccccccHHHccccEEEEEcccHHHHHHcccEEEEEccHHHHHHHHHccccEEEEEccccHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccc //