[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yjlA
DDBJ      :yjlA         putative permease
Swiss-Prot:YJLA_BACSU   RecName: Full=Uncharacterized protein yjlA;

Homologs  Archaea  3/68 : Bacteria  52/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:324 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->324 YJLA_BACSU e-168 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13083.1 GT:GENE yjlA GT:PRODUCT putative permease GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1296620..1297594) GB:FROM 1296620 GB:TO 1297594 GB:DIRECTION - GB:GENE yjlA GB:PRODUCT putative permease GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pt: putative transporter GB:PROTEIN_ID CAB13083.1 GB:DB_XREF GOA:O34428 SubtiList:BG13200 UniProtKB/Swiss-Prot:O34428 GB:GENE:GENE yjlA LENGTH 324 SQ:AASEQ MKAIVIGILASLFFAVTFILNRAMELSGGSWLWSSSLRFIFMVPFLCLIVIMRGTFTPLLLEMRKKPFYWIKWSFVGFVLFYAPITFAAAYGPGWLIAGTWQITIVAGVLLSPLFYVKQDMPGGPQLIRQKIPLVSLGTSVIILIGAALIQLQHAESLSGRMLLFSVLPVVIAAFAYPLGNRRMLEEYGGRLDTFQRVLGMTLASLPFWLILAAYGWWSDGLPTASQTVQSFIVAVSSGIIATVLFFWATDMVRDNPQKLAAVEATQSGEVIFALLGEIVLLSGVFPSLLSFAGLFIIIAGMMLHTFASQPRKPKKKAQSNLTA GT:EXON 1|1-324:0| SW:ID YJLA_BACSU SW:DE RecName: Full=Uncharacterized protein yjlA; SW:GN Name=yjlA; OrderedLocusNames=BSU12260; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->324|YJLA_BACSU|e-168|100.0|324/324| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 9 TM:REGION 2->24| TM:REGION 38->60| TM:REGION 69->89| TM:REGION 95->117| TM:REGION 131->153| TM:REGION 157->179| TM:REGION 195->216| TM:REGION 229->251| TM:REGION 278->300| SEG 26->37|lsggswlwsssl| SEG 142->153|iiligaaliqlq| OP:NHOMO 72 OP:NHOMOORG 55 OP:PATTERN --------------------------------------1-11-------------------------- ---------------------------------------------------------------------------------------------------------1--------------------------------------1----------------------------------------------1-122222122-2222221111-1222-1-1-11---------------------------1--------------------11----------------------------------------------------1--------------1----------------------------------------------------------------------------------------------------------11111111--------------------------------------------------------------------------------------------------------------------1-1----11----1-1--1------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------2-------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 307-324| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccEEccccEEcccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccc //