[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yjnA
DDBJ      :yjnA         putative integral inner membrane protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  93/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:254 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   32->251 PF01925 * TauE 2e-10 31.7 %
:HMM:PFM   6->253 PF01925 * TauE 2.2e-48 34.6 234/239  
:BLT:SWISS 41->254 YDHB_BACSU 3e-13 27.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13097.1 GT:GENE yjnA GT:PRODUCT putative integral inner membrane protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1312851..1313615) GB:FROM 1312851 GB:TO 1313615 GB:DIRECTION - GB:GENE yjnA GB:PRODUCT putative integral inner membrane protein GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pm: putative membrane component GB:PROTEIN_ID CAB13097.1 GB:DB_XREF GOA:O34578 InterPro:IPR002781 SubtiList:BG13214 UniProtKB/TrEMBL:O34578 GB:GENE:GENE yjnA LENGTH 254 SQ:AASEQ MSVSIILMGLFVGALVGLTGVGGAALLTPLLIVLGINPSIAVGTDLVYNSITKLFGVASHWRQKTINFKLVKYLAIGSIPSASLAIGILHLFPAFHQHQEEIIKHALGYVLTLVAISIIVRLFLDRKLRPNRWQLMPLENKRALTILIGVVFGFIVGLTSIGSGSLFAIAMIYLFNMKASQIVGTDIAHAFLLVTAAGILNASFGSVDYMLAANLLLGSIPGVLIGSHLSPRFSPRPLQFIMASIILVSGLKLI GT:EXON 1|1-254:0| BL:SWS:NREP 1 BL:SWS:REP 41->254|YDHB_BACSU|3e-13|27.9|201/100| TM:NTM 7 TM:REGION 13->35| TM:REGION 70->92| TM:REGION 103->125| TM:REGION 149->171| TM:REGION 183->205| TM:REGION 209->231| TM:REGION 233->254| SEG 9->31|glfvgalvgltgvggaalltpll| RP:PFM:NREP 1 RP:PFM:REP 32->251|PF01925|2e-10|31.7|208/237|TauE| HM:PFM:NREP 1 HM:PFM:REP 6->253|PF01925|2.2e-48|34.6|234/239|TauE| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF01925|IPR002781| OP:NHOMO 98 OP:NHOMOORG 95 OP:PATTERN ------------------------------------------------------1----1-------- ----------------------------------------1------1----------------------------------1--1---------------1-----------------------------------------------1--1--------------1-1-----------------------2-------11-----------21-1--------------------------------------------------------------------------------------------------------------------------------------------------1--------------1-------1-----1----------------------------1--111---1-------------------------111-1--1--------------------------------1-1-----------11111---1111111-1-1111111-1111---111--11--1111--------11-111---------------------------------------------------------11--1--2---------------------------1-----------------------------------------------------------------------------------------------------------1-1---------------1111111----1----1111-11---111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 128-139| PSIPRED ccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHc //