[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yjqA
DDBJ      :yjqA         conserved hypothetical protein; PBSX phage
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  124/915 : Eukaryota  1/199 : Viruses  1/175   --->[See Alignment]
b.55.1
:125 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   9->121 3dcxA PDBj 2e-25 51.4 %
:RPS:PDB   10->122 3dcxC PDBj 5e-34 46.8 %
:RPS:SCOP  9->122 3dcxA1  b.55.1.13 * 1e-24 48.7 %
:RPS:PFM   5->121 PF08000 * DUF1696 8e-36 62.9 %
:HMM:PFM   1->124 PF08000 * DUF1696 2.2e-56 65.0 123/124  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13104.1 GT:GENE yjqA GT:PRODUCT conserved hypothetical protein; PBSX phage GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1318528..1318905) GB:FROM 1318528 GB:TO 1318905 GB:DIRECTION - GB:GENE yjqA GB:PRODUCT conserved hypothetical protein; PBSX phage GB:FUNCTION 16.5: Explore GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function; Product type h: extrachromosomal origin GB:PROTEIN_ID CAB13104.1 GB:DB_XREF InterPro:IPR012544 SubtiList:BG13218 UniProtKB/TrEMBL:O34593 GB:GENE:GENE yjqA LENGTH 125 SQ:AASEQ MGFIDGLLGNASTLSTAAVQEELAHILLEGEKVEAAFKLVRDLIVFTDKRLILVDKQGITGKKTEFQSIPYKSISRFSVETAGRFDLDSELKIWISGAELPAVSKQFKKDESIYDIQKVLAAVCM GT:EXON 1|1-125:0| BL:PDB:NREP 1 BL:PDB:REP 9->121|3dcxA|2e-25|51.4|109/114| RP:PDB:NREP 1 RP:PDB:REP 10->122|3dcxC|5e-34|46.8|109/112| RP:PFM:NREP 1 RP:PFM:REP 5->121|PF08000|8e-36|62.9|116/123|DUF1696| HM:PFM:NREP 1 HM:PFM:REP 1->124|PF08000|2.2e-56|65.0|123/124|DUF1696| RP:SCP:NREP 1 RP:SCP:REP 9->122|3dcxA1|1e-24|48.7|113/116|b.55.1.13| OP:NHOMO 129 OP:NHOMOORG 127 OP:PATTERN --------------------------------1----------------------------------- ------1---11------------------------1--1-------11-1---1---------111-11-----------1-------------------111-1--------------------------------------1----------11------------------------------------2111111-11111111--1-12111---111111111-1---------------------1------------------------11111---1--------------------------1111111111-----11111111111-11-----1-1------11----------------------------------------------------111111111-------------------------------------------------------------------------------1---------------------------------------------1------------------------------1-----1------------1------1-------------------------------1----11-11111--1111-1111-11----------------------------------------------------------------------------------------------------------------------------------------------------1----------------------1-----11---------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----- ----------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------- STR:NPRED 122 STR:RPRED 97.6 SQ:SECSTR #cTTHHccEccEEccHHHHGHHHHGGGcTTccEEEEEEETTEEEEEEccEEEEEEEcTTTcccEEEEEEEGGGEEEEEEEEcccccccEEEEEEETTccccEEEEEEcTTccHHHHHHHHHHH## PSIPRED cccHHHHccccccccHHHHHHHHHHHHccccEEEEEEEEEEEEEEEEccEEEEEEcccccEEEEEEEEcccccEEEEEEEEccccccccEEEEEEccccEEEEEEEEcccccHHHHHHHHHHHHc //