[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ykcC
DDBJ      :ykcC         putative glycosyltransferase
Swiss-Prot:YKCC_BACSU   RecName: Full=Uncharacterized glycosyltransferase ykcC;         EC=2.4.-.-;

Homologs  Archaea  25/68 : Bacteria  613/915 : Eukaryota  128/199 : Viruses  2/175   --->[See Alignment]
c.68.1
:323 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   8->111 2z87B PDBj 1e-06 31.3 %
:RPS:PDB   7->250 3e25A PDBj 2e-24 12.7 %
:RPS:SCOP  8->297 1xhbA2  c.68.1.17 * 3e-25 11.0 %
:HMM:SCOP  1->275 1xhbA2 c.68.1.17 * 3.8e-34 22.8 %
:RPS:PFM   8->115 PF00535 * Glycos_transf_2 4e-15 34.3 %
:HMM:PFM   8->170 PF00535 * Glycos_transf_2 1.4e-36 32.5 160/169  
:HMM:PFM   214->292 PF01988 * VIT1 0.00048 23.2 69/213  
:BLT:SWISS 1->323 YKCC_BACSU 0.0 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13146.2 GT:GENE ykcC GT:PRODUCT putative glycosyltransferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1356447..1357418 GB:FROM 1356447 GB:TO 1357418 GB:DIRECTION + GB:GENE ykcC GB:PRODUCT putative glycosyltransferase GB:FUNCTION 16.2: Construct biomass (Anabolism) 16.13: Shape GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB13146.2 GB:DB_XREF GOA:O34319 InterPro:IPR001173 SubtiList:BG13230 UniProtKB/Swiss-Prot:O34319 GB:GENE:GENE ykcC LENGTH 323 SQ:AASEQ MSRHIQYSIVVPVYNEELVIHETYQRLKEVMDQTKENYELLFVNDGSKDRSIEILREHSLIDPRVKIIDFSRNFGHQIAITAGMDYAQGNAIVVIDADLQDPPELILEMIEKWKEGYEVVYAVRTKRKGETFFKKQTAAMFYRLLSGMTDIDIPIDTGDFRLMDRKVCDEMKRLKEKNPFVRGLVSWVGFKQTAVEYVRDERLAGETKYPLKKMLKLSMDGITTFSHKPLKLASYAGILMSGTGFLYMFIVLYLKLFTDSTITGWSSLIVIQLLFSGIVLLILGVIGEYIGRIYDEAKDRPLYIVQKSYGIENKRLYRDQHMS GT:EXON 1|1-323:0| SW:ID YKCC_BACSU SW:DE RecName: Full=Uncharacterized glycosyltransferase ykcC; EC=2.4.-.-; SW:GN Name=ykcC; OrderedLocusNames=BSU12890; SW:KW Cell membrane; Complete proteome; Glycosyltransferase; Membrane;Transferase; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->323|YKCC_BACSU|0.0|100.0|323/323| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016757|"GO:transferase activity, transferring glycosyl groups"|Glycosyltransferase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 2 TM:REGION 233->255| TM:REGION 267->289| BL:PDB:NREP 1 BL:PDB:REP 8->111|2z87B|1e-06|31.3|99/591| RP:PDB:NREP 1 RP:PDB:REP 7->250|3e25A|2e-24|12.7|236/270| RP:PFM:NREP 1 RP:PFM:REP 8->115|PF00535|4e-15|34.3|105/148|Glycos_transf_2| HM:PFM:NREP 2 HM:PFM:REP 8->170|PF00535|1.4e-36|32.5|160/169|Glycos_transf_2| HM:PFM:REP 214->292|PF01988|0.00048|23.2|69/213|VIT1| RP:SCP:NREP 1 RP:SCP:REP 8->297|1xhbA2|3e-25|11.0|290/316|c.68.1.17| HM:SCP:REP 1->275|1xhbA2|3.8e-34|22.8|272/0|c.68.1.17|1/1|Nucleotide-diphospho-sugar transferases| OP:NHOMO 1339 OP:NHOMOORG 768 OP:PATTERN ---11------------11--1-1--------32---------21-3223123-1122313--1---- 346-3------------11-1---2-11111-----12--111121---11---------21--113-4111111---12-2-1111133431422---12234215811--------------12322322223212255---33267676711--22212233-19855222111132111-----1-1112111112212121221223324111133-2--311312-211111111111111111112113144221113322231112233481111111122211211121211111111111111211112111221-5311111113232122-1--1-3---21--1122212111---2--1-241112-----114421112311111111111111---1--2---42-1--133142211221---------1--222222221--21511--------------------------------1-1211124333331111122132222123214234212311-1111-1111342-11121-------112-421234-211274222-5422224431121-2231--11------------------12222212121---1--------------21-42------1------11221122112222222-1221211321122222222112111212-233223434232351111222231111111111-11--1-1111111112-111-----11-1------32333-21---122221121-1122-121334344343----1-----1-1--22122221111222--31321122--------1----------------------------1-2------233 11-1-1--1---11-11111111111-1111111111111111111-1111111-11-1111-11-11-1-11-111111-1111111----1-----------1--1--211--1---1-11-2112-461-2121-1-1-11211---1-14---12-211111-1111---11-------1111221--112111- ---------------------------------------------------1-1------------------------------------------------------------------------------------------------------------------------- STR:NPRED 256 STR:RPRED 79.3 SQ:SECSTR cccccEEEEEEEEcccTTTHHHHHHHHHTTGGGcTTccEEEEEEccccccHHHHHHHTTcEEEEHHcTTccccccHHHHHHHHHHHccccEEEEccccccccTTHHHHHcHHHHHcccccEEEEEcccHHHHTHHHHHHHHcGGGTTcccTGcccTTcccEEEEHHHHHHcccccGHHHHHHHHHHHcTTcEEEEEccccccccHHHHHHHHHHHHHHHHHTTccccccccEEccccEEccccccccccHEccccc################################################################### PSIPRED cccccEEEEEEEcccHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHcccEEEEEEEEccccHHHHHHHHHHHHHHHHHHcccccEEccccEEEEEHHHHHHHHccccccccHHHHHHHccccEEEEEEEEEcccccEEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccccccccHHHHcc //