[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ykgB
DDBJ      :ykgB         putative 6-phosphogluconolactonase
Swiss-Prot:YKGB_BACSU   RecName: Full=Uncharacterized protein ykgB;

Homologs  Archaea  1/68 : Bacteria  310/915 : Eukaryota  66/199 : Viruses  0/175   --->[See Alignment]
b.69.2b.70.2
:349 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   9->346 3hfqA PDBj 1e-73 42.3 %
:RPS:PDB   161->334 1c5kA PDBj 2e-04 21.4 %
:RPS:SCOP  155->343 1jmxB  b.69.2.2 * 4e-11 12.6 %
:HMM:SCOP  11->347 1qksA2 b.70.2.1 * 1.1e-45 26.6 %
:RPS:PFM   18->330 PF10282 * Muc_lac_enz 2e-69 47.0 %
:HMM:PFM   6->345 PF10282 * Muc_lac_enz 4.5e-135 48.8 340/345  
:BLT:SWISS 1->349 YKGB_BACSU 0.0 100.0 %
:REPEAT 3|49->125|154->238|253->338

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13158.1 GT:GENE ykgB GT:PRODUCT putative 6-phosphogluconolactonase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1369876..1370925) GB:FROM 1369876 GB:TO 1370925 GB:DIRECTION - GB:GENE ykgB GB:PRODUCT putative 6-phosphogluconolactonase GB:FUNCTION 16.2: Construct biomass (Anabolism) 16.11: Scavenge (Catabolism) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB13158.1 GB:DB_XREF InterPro:IPR015943 SubtiList:BG13236 UniProtKB/Swiss-Prot:O34499 GB:GENE:GENE ykgB LENGTH 349 SQ:AASEQ MTKYIGYVGTYTKGGSEGIYSFELDTEKKALSEPKLAAKLGNPTYVATNKNNTILYSIEKADGQGGVAAYQIDKNSGELTFLNHQLIDGPSPCHVSVDDQNQFVLTANYHSGKVHVFPVQEDGSLQSPVSEAAHTGKGPHERQEKPHTHYAGFTPEHNYVVAVDLGIDKLYTYKLKDGVLTESGSHSFAPGAGPRHIAFHPKEKYAYVMTELSNEVIALEYNPTAGEFREIQVVSAIPDDFTDNSQGSAIHVTQDGRFVYVANRGHDSIAVFEVNQYSGELAFVERVSTEGNWPRDFVFDPTEGFLVASNEETGNLVLFERDKETGRLTLLPSTVSVPYPVCVKFLHQV GT:EXON 1|1-349:0| SW:ID YKGB_BACSU SW:DE RecName: Full=Uncharacterized protein ykgB; SW:GN Name=ykgB; OrderedLocusNames=BSU13010; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->349|YKGB_BACSU|0.0|100.0|349/349| NREPEAT 1 REPEAT 3|49->125|154->238|253->338| BL:PDB:NREP 1 BL:PDB:REP 9->346|3hfqA|1e-73|42.3|331/338| RP:PDB:NREP 1 RP:PDB:REP 161->334|1c5kA|2e-04|21.4|154/397| RP:PFM:NREP 1 RP:PFM:REP 18->330|PF10282|2e-69|47.0|300/311|Muc_lac_enz| HM:PFM:NREP 1 HM:PFM:REP 6->345|PF10282|4.5e-135|48.8|340/345|Muc_lac_enz| RP:SCP:NREP 1 RP:SCP:REP 155->343|1jmxB|4e-11|12.6|182/339|b.69.2.2| HM:SCP:REP 11->347|1qksA2|1.1e-45|26.6|304/0|b.70.2.1|1/1|C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase| OP:NHOMO 491 OP:NHOMOORG 377 OP:PATTERN ---------------------------1---------------------------------------- 2-2-2---------------------------------1------21-111111---1--11-11-22221---------1-------1121--------12-1-2-2-1-----------------------------------------------------------------------------------11111111111111111-1111112----2--111111-21111111111111111111111111112111111111111211111-------1--11111111111-------------111---1111---11-------1-1-----1111-----1--------------------1-2---------1-111---------------------------1----1-------------1------------11111111-111--------------------------------------------333213211112213111111211------124-----1-1-2----------------------------------------------------1-----------------------------1-1--1------------------------1------11-1111112-211111111111-1111111111111--11-2222221111111111111111111211111111-2111111-1111111------------------------------111111----1-11111112-11111222-------------------11111------------------22--------------1------------------------------------2- ------2--------1121111112-1------1111111-11---1133333244321211------------------------11-1211211-331-3-1-1-15------------------------------------------------------------------1--14---------2-11254571 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 339 STR:RPRED 97.1 SQ:SECSTR #######EEEcccccccEEEEEEEETTTTEEEEEEEEEEccccccEEEcTTcEEEEEEEEETTEEEEEEEEEETTEEEEEEEEEEEEEcccccEEEEETTTTEEEEEETTTTEEEEEEEcTTccEcEEEEEEEcccccccTTcccccEEEEEEcTTcccEEEcTTcccEEEEEETTTcEEEcccccEEEETccEEEEEEcTTccEEEEEcTTcccEEEEEEETTTccEEEccEEEcccTTccccccEEEEEEcTTccEEEEEEcTTcccEEEEEETTccccEEEEEccccccEEEEEEEcTTccEEEEEEEETTEEEEEEEETTTccEEEccccEEcTTEEEEEEc### PSIPRED cccEEEEEEEEcccccccEEEEEEEccccEEEEEEEEccccccEEEEEcccccEEEEEEccccccEEEEEEEEccccEEEEEEEEEccccccEEEEEcccccEEEEEEccccEEEEEEEcccccEEEEEEEEEEcccccccccccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEEEEccccccccEEEEcccccEEEEEEcccccEEEEEEEccccEEEEEEEEEEEcccccccccccEEEEcccccEEEEEccccccEEEEEEcccccEEEEEEEEcccccccEEEEEcccccEEEEEEccccEEEEEEEEccccEEEEEccEEEccccEEEEEEEcc //