[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yknY
DDBJ      :yknY         putative ABC transporter (ATP-binding protein)
Swiss-Prot:YKNY_BACSU   RecName: Full=Uncharacterized ABC transporter ATP-binding protein yknY;         EC=3.6.3.-;

Homologs  Archaea  68/68 : Bacteria  909/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:230 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->218 1l2tB PDBj 1e-60 53.2 %
:RPS:PDB   2->219 3b5jA PDBj 5e-49 28.4 %
:RPS:SCOP  1->216 1sgwA  c.37.1.12 * 6e-46 19.4 %
:HMM:SCOP  4->219 1ii8.1 c.37.1.12 * 1.8e-65 39.3 %
:RPS:PFM   45->169 PF00005 * ABC_tran 2e-22 47.5 %
:HMM:PFM   45->169 PF00005 * ABC_tran 2e-29 38.8 116/118  
:HMM:PFM   21->51 PF03193 * DUF258 1.6e-05 26.7 30/161  
:BLT:SWISS 1->230 YKNY_BACSU e-129 100.0 %
:PROS 142->156|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13309.1 GT:GENE yknY GT:PRODUCT putative ABC transporter (ATP-binding protein) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1505416..1506108 GB:FROM 1505416 GB:TO 1506108 GB:DIRECTION + GB:GENE yknY GB:PRODUCT putative ABC transporter (ATP-binding protein) GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 9987136; Product type pt : putative transporter GB:PROTEIN_ID CAB13309.1 GB:DB_XREF GOA:O31711 HSSP:1L2T InterPro:IPR003593 SubtiList:BG13245 UniProtKB/Swiss-Prot:O31711 GB:GENE:GENE yknY LENGTH 230 SQ:AASEQ MIQLSNVRKSYQIGKETFDVLHSIDLDIHQGEYVSIMGPSGSGKSTIMNIIGCLDRPTSGTYQLDGEDISSYKDKELAAVRNRSIGFVFQQFQLLPRLNAKKNVELPMIYSGIGKKERQERAERALEKVGLADRMLHMPNELSGGQKQRVAIARAIVNEPKLILADEPTGALDTKTSEAIMDQFTALNAEGTTIVLVTHEPEVADCTNRIVMVRDGNIVPASSGQRSVGE GT:EXON 1|1-230:0| SW:ID YKNY_BACSU SW:DE RecName: Full=Uncharacterized ABC transporter ATP-binding protein yknY; EC=3.6.3.-; SW:GN Name=yknY; OrderedLocusNames=BSU14360; SW:KW ATP-binding; Complete proteome; Hydrolase; Nucleotide-binding;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->230|YKNY_BACSU|e-129|100.0|230/230| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 142->156|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 1->218|1l2tB|1e-60|53.2|218/232| RP:PDB:NREP 1 RP:PDB:REP 2->219|3b5jA|5e-49|28.4|215/243| RP:PFM:NREP 1 RP:PFM:REP 45->169|PF00005|2e-22|47.5|118/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 45->169|PF00005|2e-29|38.8|116/118|ABC_tran| HM:PFM:REP 21->51|PF03193|1.6e-05|26.7|30/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->216|1sgwA|6e-46|19.4|196/200|c.37.1.12| HM:SCP:REP 4->219|1ii8.1|1.8e-65|39.3|211/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 55880 OP:NHOMOORG 1174 OP:PATTERN WWOBTNKNZYZVZVbRoKSTPSSc*PTopckaLEFCDCHGHFDWdUYqOT**n9TiUYbPWMLGb1BC Xg*U*lkmsswYiWcabPO-OqCCb*PPPPPQywuy****a*f****mywma***SVoEE***r*y****geddd*fcgT*ktDCE9CWWVO6RIMM-1GGUNNNkRcRY9CBBBBBDDDCCCCHWSNWdRQXYdXq****NMN*f*ns*jjqfpYZSNQMSLjmdo***gMULPONMTMPLNqejUSzqBWh*************************kr***sx****z***brsrqrnnoorrronchcjh*lfh**fRldr*zRS**fYXbpmnnpwuy*yu****x*wwssy*uywhhgfgikkljigh*tskjktrupr***********n*rv***gnoi*ul***ksUM**zoaflqTZmftnRhfgPeaXXOMNNMMha***fZw****************-z**wt*w***UD**************NOO**********VUVVVVVV*fjNVpd*776675556679A8CD8A9A89AAAA6B6MFIKFG************************w********DN**x*t*ry******fwoRaOWrdJLJILJJWVUesqg**Sia*qatzgetLgfcVaemZfdfcfz*a*LOOTHPPPQNJBEEFFDEDEIXHJMTSyw*U*YiOYQ*UXZbWPahZVWWaYhcZif5-FOZTN321333****a************-************************ssnuwqtsvuuvtrsvstr**vx****Z6************44LHGIFFGPRSRWL*v*geebcZLSVRPXRXkQSUSSIUHPWxf*************q***IFFEFGGFFOkus*wxxxx*****VYVQPRQPRRHGGG97OWZZNONPA8798999*DeDDEEE-IHIDMKFONLDJQDJHAACcr*bax*xutDgP 2366piN-oQBDXlXJJQKPVZScTdaKKDEFFQMOFQILIKMEECNLQWXSiUMNRELEDFHEF8CB3DD7EFJAE3AGEECBFJ89-LNBJIGGHDEEB7IOMG6atvyZhZnjiPJJGKYOzwG*H**s4vV*KOLGjHJuaIQLLFeFF*IdYVzQu*TyVmH*im*dmnVJPLO*POOOY****J**SO****e ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 224-230| PSIPRED cEEEEEEEEEEccccEEEEEEcccEEEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHHHHHHccEEEEEEcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHcccccccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHccEEEEEEccEEEEcccccccccc //