[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ykoJ
DDBJ      :ykoJ         putative exported protein
Swiss-Prot:YKOJ_BACSU   RecName: Full=Uncharacterized protein ykoJ;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.1
:170 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  109->167 2gu3A1  d.17.1.6 * 5e-09 18.6 %
:RPS:PFM   109->167 PF03413 * PepSY 7e-06 42.4 %
:HMM:PFM   41->97 PF03413 * PepSY 1.6e-09 31.6 57/64  
:HMM:PFM   108->167 PF03413 * PepSY 1.3e-13 38.3 60/64  
:HMM:PFM   7->64 PF06474 * MLTD_N 0.00028 21.7 46/95  
:BLT:SWISS 1->170 YKOJ_BACSU 2e-74 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13185.1 GT:GENE ykoJ GT:PRODUCT putative exported protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1394776..1395288 GB:FROM 1394776 GB:TO 1395288 GB:DIRECTION + GB:GENE ykoJ GB:PRODUCT putative exported protein GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 17209068; Product type ph : phenotype GB:PROTEIN_ID CAB13185.1 GB:DB_XREF GOA:O35012 InterPro:IPR005075 SubtiList:BG13255 UniProtKB/TrEMBL:O35012 GB:GENE:GENE ykoJ LENGTH 170 SQ:AASEQ MLKKKWMVGLLAGCLAAGGFSYNAFATENNENRQASSKTDALTEQEAEAIAKTVVDGTVEDIDRDLYNGKEVYEVEIEKEGEDYDVYVDIHTKQALNDPLKEKAEQVAITKEEAEEIALKQTGGTVTESKLDEDDGAYIYEMEIQTKQGTETEFEISAKDGRIIKQEIDD GT:EXON 1|1-170:0| SW:ID YKOJ_BACSU SW:DE RecName: Full=Uncharacterized protein ykoJ;Flags: Precursor; SW:GN Name=ykoJ; OrderedLocusNames=BSU13280; SW:KW Complete proteome; Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->170|YKOJ_BACSU|2e-74|100.0|170/170| TM:NTM 1 TM:REGION 6->28| SEG 9->19|gllagclaagg| SEG 69->85|gkevyeveiekegedyd| RP:PFM:NREP 1 RP:PFM:REP 109->167|PF03413|7e-06|42.4|59/61|PepSY| HM:PFM:NREP 3 HM:PFM:REP 41->97|PF03413|1.6e-09|31.6|57/64|PepSY| HM:PFM:REP 108->167|PF03413|1.3e-13|38.3|60/64|PepSY| HM:PFM:REP 7->64|PF06474|0.00028|21.7|46/95|MLTD_N| GO:PFM:NREP 4 GO:PFM GO:0005576|"GO:extracellular region"|PF03413|IPR005075| GO:PFM GO:0006508|"GO:proteolysis"|PF03413|IPR005075| GO:PFM GO:0008237|"GO:metallopeptidase activity"|PF03413|IPR005075| GO:PFM GO:0008270|"GO:zinc ion binding"|PF03413|IPR005075| RP:SCP:NREP 1 RP:SCP:REP 109->167|2gu3A1|5e-09|18.6|59/63|d.17.1.6| OP:NHOMO 8 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------2---12-------2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 26-42, 97-116, 165-170| PSIPRED ccHHHHHHHHHHHHHHHHHHEEEEEHEEcccccccccccccccHHHHHHHHHHHcccEEEEEEEEcccccEEEEEEEEEccEEEEEEEEccccEEEccHHHHHHccccccHHHHHHHHHHccccEEEEEEEEHHcccEEEEEEEEEcccEEEEEEEEccccEEEEEEccc //