[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ykoL
DDBJ      :ykoL         hypothetical protein
Swiss-Prot:YKOL_BACSU   RecName: Full=Stress response protein ykoL;

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:60 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->60 YKOL_BACSU 1e-31 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13190.1 GT:GENE ykoL GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1398181..1398363 GB:FROM 1398181 GB:TO 1398363 GB:DIRECTION + GB:GENE ykoL GB:PRODUCT hypothetical protein GB:NOTE Evidence 5: No homology to any previously reported sequences; PubMedId: 10671441 GB:PROTEIN_ID CAB13190.1 GB:DB_XREF GOA:O34763 SubtiList:BG13257 UniProtKB/Swiss-Prot:O34763 GB:GENE:GENE ykoL LENGTH 60 SQ:AASEQ MSNLLKSALEKERRHYSEKLYQIGVYNKEVMNKMTISELRKEYAYFFRSITNHKNYPYTR GT:EXON 1|1-60:0| SW:ID YKOL_BACSU SW:DE RecName: Full=Stress response protein ykoL; SW:GN Name=ykoL; OrderedLocusNames=BSU13330; SW:KW Complete proteome; Stress response. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->60|YKOL_BACSU|1e-31|100.0|60/100| GO:SWS:NREP 1 GO:SWS GO:0006950|"GO:response to stress"|Stress response| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 54-56, 58-60| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //