[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ykoX
DDBJ      :ykoX         putative integral inner membrane protein
Swiss-Prot:YKOX_BACSU   RecName: Full=Uncharacterized membrane protein ykoX;

Homologs  Archaea  16/68 : Bacteria  232/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:221 amino acids
:PSIPRED
:RPS:PFM   77->166 PF09335 * SNARE_assoc 3e-10 38.4 %
:HMM:PFM   41->166 PF09335 * SNARE_assoc 1.9e-25 32.2 115/123  
:BLT:SWISS 1->221 YKOX_BACSU e-107 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13200.1 GT:GENE ykoX GT:PRODUCT putative integral inner membrane protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1409912..1410577 GB:FROM 1409912 GB:TO 1410577 GB:DIRECTION + GB:GENE ykoX GB:PRODUCT putative integral inner membrane protein GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pm: putative membrane component GB:PROTEIN_ID CAB13200.1 GB:DB_XREF InterPro:IPR015414 SubtiList:BG13267 UniProtKB/TrEMBL:O34908 GB:GENE:GENE ykoX LENGTH 221 SQ:AASEQ MIHKHETRELVAIEELVMSWIEAFKSLSYFGIFLALSIEFIPAEVVLPLAGYWVSKGDMTLAGVVLAGSLGGVAGPLTLYWIGRYGGRPFLERFGKYLFIKPEALDKSDNFFKKHGGFVAFSGRFLPGIRTLISIPCGIAKMNVWVFSLYTFIAMLPITFVYVYLGVKLGENWKAVGSILDQYMLPIGIAILALFLLYLLMKKRKKRTHSEQLSVFLKNKR GT:EXON 1|1-221:0| SW:ID YKOX_BACSU SW:DE RecName: Full=Uncharacterized membrane protein ykoX; SW:GN Name=ykoX; OrderedLocusNames=BSU13430; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->221|YKOX_BACSU|e-107|100.0|221/221| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 5 TM:REGION 30->52| TM:REGION 60->82| TM:REGION 119->141| TM:REGION 147->168| TM:REGION 180->201| SEG 61->75|lagvvlagslggvag| SEG 192->206|lalfllyllmkkrkk| RP:PFM:NREP 1 RP:PFM:REP 77->166|PF09335|3e-10|38.4|86/119|SNARE_assoc| HM:PFM:NREP 1 HM:PFM:REP 41->166|PF09335|1.9e-25|32.2|115/123|SNARE_assoc| OP:NHOMO 352 OP:NHOMOORG 248 OP:PATTERN ------1111111111-1--------------------------1----------------111---1 1221---1111----------1----------------------1111111-1-111---11--111-12--111111--1-2----11111------------------------------------------1-111-----11-121--1--11111111-2-1111-111111111111111-----2-344444445243455411332344423211232222222221111111111111131112-1-1----111--11---11---111--------------------------------------------1--1111111-1---1-11-3441----1--1211322----11111-----1---1---------------1-----------------1---------------------------1---------------1-----1--------------------------------1-1-------------------1---------1--------------------11-11-11------------------1----------1111111-11111---1111111111-1-1-------111-1------------------------------------1----------------------------------------------------------------------------------------------------------------------------------111-1------------------------------------------------------------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //