[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ykuH
DDBJ      :ykuH         hypothetical protein
Swiss-Prot:YKUH_BACSU   RecName: Full=Uncharacterized protein ykuH;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:182 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 21->182 YKUH_BACSU 7e-96 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13281.1 GT:GENE ykuH GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1481547..1482095 GB:FROM 1481547 GB:TO 1482095 GB:DIRECTION + GB:GENE ykuH GB:PRODUCT hypothetical protein GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB13281.1 GB:DB_XREF GOA:O31696 SubtiList:BG13292 UniProtKB/Swiss-Prot:O31696 GB:GENE:GENE ykuH LENGTH 182 SQ:AASEQ MKKLLKKLVVLFLSSLVIIFNVWYFIICAFSPEYYQNTNLTSNEIIRFEKLYHIDFPDETKFIKAREYLAGPGGDTSAVLYVSLPTKRVEKVLSDYTYMKINYTDNVGSMYGVDVSKSVAGLTTLTFGTYDKKGTFYNMKHDDDWMYKGTDWNLYFWTAASYNAVIFVFVLVIVKQMNKILN GT:EXON 1|1-182:0| SW:ID YKUH_BACSU SW:DE RecName: Full=Uncharacterized protein ykuH;Flags: Precursor; SW:GN Name=ykuH; OrderedLocusNames=BSU14080; SW:KW Complete proteome; Membrane; Signal; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 21->182|YKUH_BACSU|7e-96|100.0|162/182| GO:SWS:NREP 2 GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 1 TM:REGION 8->30| SEG 2->20|kkllkklvvlflsslviif| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHEEEcccccHHccccccHHHEEEEEEEEEEccccccHHHHHHHHHcccccccEEEEEEEccHHHHHHHHcccEEEEEEEEcccccEEEccHHHHHHcEEEEEEccccccccEEEccccccEEEEcccccEEEEEcccccHHHHHHHHHHHHHHHHHcc //