[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ykuJ
DDBJ      :ykuJ         conserved hypothetical protein
Swiss-Prot:YKUJ_BACSU   RecName: Full=Uncharacterized protein ykuJ;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.317.1
:79 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->79 2ffgB PDBj 4e-36 98.6 %
:RPS:SCOP  2->79 2ffgA1  d.317.1.1 * 1e-25 96.2 %
:HMM:SCOP  2->79 2ffgA1 d.317.1.1 * 3.2e-31 53.8 %
:RPS:PFM   7->78 PF08796 * DUF1797 3e-14 62.7 %
:HMM:PFM   7->78 PF08796 * DUF1797 3e-29 52.2 67/67  
:BLT:SWISS 1->79 YKUJ_BACSU 5e-42 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13283.1 GT:GENE ykuJ GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1484117..1484356 GB:FROM 1484117 GB:TO 1484356 GB:DIRECTION + GB:GENE ykuJ GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13283.1 GB:DB_XREF InterPro:IPR014904 PDB:2FFG SubtiList:BG13294 UniProtKB/Swiss-Prot:O34588 GB:GENE:GENE ykuJ LENGTH 79 SQ:AASEQ MSQLMGIITRLQSLQETAEAANEPMQRYFEVNGEKICSVKYFEKNQTFELTVFQKGEKPNTYPFDNIDMVSIEIFELLQ GT:EXON 1|1-79:0| SW:ID YKUJ_BACSU SW:DE RecName: Full=Uncharacterized protein ykuJ;Flags: Precursor; SW:GN Name=ykuJ; OrderedLocusNames=BSU14100; SW:KW 3D-structure; Complete proteome; Signal. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->79|YKUJ_BACSU|5e-42|100.0|79/100| BL:PDB:NREP 1 BL:PDB:REP 5->79|2ffgB|4e-36|98.6|73/76| RP:PFM:NREP 1 RP:PFM:REP 7->78|PF08796|3e-14|62.7|67/67|DUF1797| HM:PFM:NREP 1 HM:PFM:REP 7->78|PF08796|3e-29|52.2|67/67|DUF1797| RP:SCP:NREP 1 RP:SCP:REP 2->79|2ffgA1|1e-25|96.2|78/78|d.317.1.1| HM:SCP:REP 2->79|2ffgA1|3.2e-31|53.8|78/0|d.317.1.1|1/1|YkuJ-like| OP:NHOMO 30 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111---11111-1-------111111----------------------1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 73 STR:RPRED 92.4 SQ:SECSTR ####HHHHHHHHHHHHHHTTTTcc#EEEEEETTEEEEEEEEETTTTEEEEEEccTTcccEEEEEccHH#HHHHHHHHHH DISOP:02AL 78-80| PSIPRED cHHHHHHHHHHHHHHHcccccccEEEEEEEEccEEEEEEEEEccccEEEEEEccccccccEEEcccEEEEEHHHHHHHc //