[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ykvN
DDBJ      :ykvN         putative transcriptional regulator
Swiss-Prot:YKVN_BACSU   RecName: Full=Uncharacterized HTH-type transcriptional regulator ykvN;

Homologs  Archaea  20/68 : Bacteria  448/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->89 2hztA PDBj 3e-22 68.8 %
:RPS:PDB   9->92 2e1nB PDBj 1e-08 17.9 %
:RPS:SCOP  6->95 1z7uA1  a.4.5.69 * 7e-32 41.1 %
:HMM:SCOP  1->100 2fswA1 a.4.5.69 * 3.2e-29 47.0 %
:RPS:PFM   15->95 PF01638 * HxlR 5e-24 64.2 %
:HMM:PFM   14->103 PF01638 * HxlR 4e-42 60.0 90/91  
:BLT:SWISS 1->118 YKVN_BACSU 9e-55 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13249.1 GT:GENE ykvN GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1442347..1442703) GB:FROM 1442347 GB:TO 1442703 GB:DIRECTION - GB:GENE ykvN GB:PRODUCT putative transcriptional regulator GB:FUNCTION 16.3: Control GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 16683018; Product type pr : putative regulator GB:PROTEIN_ID CAB13249.1 GB:DB_XREF GOA:O31679 InterPro:IPR002577 SubtiList:BG13316 UniProtKB/Swiss-Prot:O31679 GB:GENE:GENE ykvN LENGTH 118 SQ:AASEQ MKKFSCGFEVTKEVIGGKWKGLVLYFLMNGPKRTSELKRIIPNITQKMLIQTLRELEASGLVSRKMYNQVPPKVEYSSTELGESLKPILQELCQWGGYYAEQEYAEGEYEIVQPEQLS GT:EXON 1|1-118:0| SW:ID YKVN_BACSU SW:DE RecName: Full=Uncharacterized HTH-type transcriptional regulator ykvN; SW:GN Name=ykvN; OrderedLocusNames=BSU13760; SW:KW Complete proteome; DNA-binding; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->118|YKVN_BACSU|9e-55|100.0|118/118| GO:SWS:NREP 3 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| SEG 96->110|ggyyaeqeyaegeye| BL:PDB:NREP 1 BL:PDB:REP 9->89|2hztA|3e-22|68.8|77/91| RP:PDB:NREP 1 RP:PDB:REP 9->92|2e1nB|1e-08|17.9|84/112| RP:PFM:NREP 1 RP:PFM:REP 15->95|PF01638|5e-24|64.2|81/91|HxlR| HM:PFM:NREP 1 HM:PFM:REP 14->103|PF01638|4e-42|60.0|90/91|HxlR| RP:SCP:NREP 1 RP:SCP:REP 6->95|1z7uA1|7e-32|41.1|90/108|a.4.5.69| HM:SCP:REP 1->100|2fswA1|3.2e-29|47.0|100/0|a.4.5.69|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 1149 OP:NHOMOORG 473 OP:PATTERN 11-------------1--------11111111--1----1---481-1--111--------------- 2---8--2222---1----------5-------1114333-95932-1-1--311--2--211-5-6966------11--231-1-1-1211-12------9---W5C-2----------------------------------214-1322---111-----11-11221-------------------121799999A5936B978A468888819--15364322222CI1------1--11---2---23-5-22--1--65222242313-243---1-----1------------1111-1111111-11---11111--8H2223222141-7111-2121----1---341------1---2-321-1133------43444--13222-----------3-23142327161-7664641566234251--331--1-1211111111-323---2-----------------------------2-1112-----244252-22221131222222322--2-----31-1--21111--2--11-2----------1-1-111-1111-31111-11---11111---21-13-11-2121-1-1--------2---111--2--1-----11-1-1-------------------------2136-3-1111111111-111111111111111111111164--11111--1---11111121111111--211111111111---------1111-1522---211-----1--144344-1----1----1113------123-------------1-----1-1--32131321111111---2----------------1----1-------------------------------12 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------3--------------1--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 80.5 SQ:SECSTR EEEEEcTTcccEEccHHHHHHHHHHHHTTccEEHHHHHHHHHEccHHHHHHHHHHHHHTTcEEEccTTccccEEEEEEccccccHHHHHHHHHHH####################### DISOP:02AL 1-3, 108-114, 116-118| PSIPRED cccccccHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHcccEEEEEccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccc //