[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ykwD
DDBJ      :ykwD         conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  213/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
d.111.1
:257 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   136->254 1cfeA PDBj 4e-22 11.0 %
:RPS:SCOP  136->254 1cfeA  d.111.1.1 * 2e-22 11.0 %
:HMM:SCOP  131->254 1smbA_ d.111.1.1 * 1.3e-24 32.4 %
:RPS:PFM   141->247 PF00188 * CAP 4e-10 36.4 %
:HMM:PFM   142->254 PF00188 * CAP 1.3e-26 27.4 113/124  
:HMM:PFM   30->140 PF11017 * DUF2855 0.00036 15.4 104/314  
:BLT:SWISS 21->161 110KD_PLAKN 4e-05 18.7 %
:BLT:SWISS 148->243 Y689_BORBU 3e-06 31.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13270.2 GT:GENE ykwD GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1466638..1467411) GB:FROM 1466638 GB:TO 1467411 GB:DIRECTION - GB:GENE ykwD GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13270.2 GB:DB_XREF InterPro:IPR014258 SubtiList:BG13329 UniProtKB/TrEMBL:O31398 GB:GENE:GENE ykwD LENGTH 257 SQ:AASEQ MKKAFILSAAAAVGLFTFGGVQQASAKELSCQPVVTVKTGNTVQNMSLNDAVKKLHINTNIKTLNAANEKEMKQLLQKHAKQSNVKVQDVQKTETAKPAQKTTEKAAADQNTASKAPATAEKTNTTTSAPSSVSAYEKKVVELTNAERQKQGLKPLQIDETLSKSARAKSQDMKDKNYFDHQSPTYGSPFDMMKSFGISYKTAGENIAKGQKTPEEVVKAWMNSEGHRKNILNPNFTHIGVGYVESGSIWTQQFIGK GT:EXON 1|1-257:0| BL:SWS:NREP 2 BL:SWS:REP 21->161|110KD_PLAKN|4e-05|18.7|139/296| BL:SWS:REP 148->243|Y689_BORBU|3e-06|31.5|92/155| RP:PDB:NREP 1 RP:PDB:REP 136->254|1cfeA|4e-22|11.0|118/135| RP:PFM:NREP 1 RP:PFM:REP 141->247|PF00188|4e-10|36.4|107/122|CAP| HM:PFM:NREP 2 HM:PFM:REP 142->254|PF00188|1.3e-26|27.4|113/124|CAP| HM:PFM:REP 30->140|PF11017|0.00036|15.4|104/314|DUF2855| RP:SCP:NREP 1 RP:SCP:REP 136->254|1cfeA|2e-22|11.0|118/135|d.111.1.1| HM:SCP:REP 131->254|1smbA_|1.3e-24|32.4|111/149|d.111.1.1|1/1|PR-1-like| OP:NHOMO 406 OP:NHOMOORG 225 OP:PATTERN --------------------------------------11111-----------------------1- -11-2---11---------------------------1---223----------------22--4121331-----------3-----------------11---1------------------------------11123---2141-1--------------211112-------------323------22222222222222222232222222132431311111152-111111-111111-11111--1-------------------------------------------------------------------15214222222212122111111223--21-1111223-2111-112--1----112------------------11111111111---------1---1---1----------1--2-2222111-----------------------------------------------------------------------------------------1-----------------------------1--1---------------1-----------111----------------------------------1--------------------------1-----------------------------------------------------------------------------------------------------1111--3-----------------111111----1-11111121111111222-------------1------1--------------------122------------1---------------------------------------- -----2-------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------IEDM- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 45.9 SQ:SECSTR #######################################################################################################################################cHHHHHHHHHHHHHHTTccccEEccHHHHHHHHHHHHHTTTccccccccccccEEccccccHHHHHHHHHTTGGGE#EGGGTEEccccccccHHHHHcTTccEEEEEEEEcTTEEEEEc### DISOP:02AL 257-258| PSIPRED cHHHHHHHHHHHHHHHHHHHccccccccccccccccEEcccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEcHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHcccccccEEEEEccccccHHHHHHHHcccHHHHHHHHcccccEEEEEEEccccEEEEEEEcc //