[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ykzD
DDBJ      :ykzD         conserved hypothetical protein
Swiss-Prot:YKZD_BACSU   RecName: Full=Uncharacterized protein ykzD;

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:45 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   9->45 PF11132 * SplA 8e-04 56.8 %
:HMM:PFM   8->42 PF11132 * SplA 1.3e-12 51.4 35/75  
:BLT:SWISS 1->45 YKZD_BACSU 2e-23 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13186.1 GT:GENE ykzD GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1395371..1395508 GB:FROM 1395371 GB:TO 1395508 GB:DIRECTION + GB:GENE ykzD GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13186.1 GB:DB_XREF SubtiList:BG13332 UniProtKB/Swiss-Prot:O34405 GB:GENE:GENE ykzD LENGTH 45 SQ:AASEQ MEKKEEQYINQAEYVPHPTKEGEYALFLHETYHLLSEDDETQTTE GT:EXON 1|1-45:0| SW:ID YKZD_BACSU SW:DE RecName: Full=Uncharacterized protein ykzD; SW:GN Name=ykzD; OrderedLocusNames=BSU13290; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->45|YKZD_BACSU|2e-23|100.0|45/45| RP:PFM:NREP 1 RP:PFM:REP 9->45|PF11132|8e-04|56.8|37/74|SplA| HM:PFM:NREP 1 HM:PFM:REP 8->42|PF11132|1.3e-12|51.4|35/75|SplA| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 38-45| PSIPRED ccccHHHHHccccccccccccccEEEEEEcHHHHHcccccccccc //