[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ykzF
DDBJ      :ykzF         conserved hypothetical protein
Swiss-Prot:YKZF_BACSU   RecName: Full=Uncharacterized protein ykzF;

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:65 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->59 PF11126 * Phage_DsbA 0.00041 34.3 35/69  
:BLT:SWISS 1->65 YKZF_BACSU 3e-33 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13285.1 GT:GENE ykzF GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1485118..1485315 GB:FROM 1485118 GB:TO 1485315 GB:DIRECTION + GB:GENE ykzF GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13285.1 GB:DB_XREF SubtiList:BG13334 UniProtKB/Swiss-Prot:O31697 GB:GENE:GENE ykzF LENGTH 65 SQ:AASEQ MRMSLIGERFTEEEQKLLLNILINHEYAIELLSSEINDIETGTKNVDGTTYKKLVTLYDRFRFEN GT:EXON 1|1-65:0| SW:ID YKZF_BACSU SW:DE RecName: Full=Uncharacterized protein ykzF; SW:GN Name=ykzF; OrderedLocusNames=BSU14120; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->65|YKZF_BACSU|3e-33|100.0|65/100| HM:PFM:NREP 1 HM:PFM:REP 25->59|PF11126|0.00041|34.3|35/69|Phage_DsbA| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED cccHHHHHHccHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccc //