[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yllA
DDBJ      :yllA         putative nucleoid associated protein
Swiss-Prot:YLLA_BACSU   RecName: Full=UPF0747 protein yllA;

Homologs  Archaea  0/68 : Bacteria  92/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:539 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->539 PF10079 * DUF2317 e-125 44.8 %
:HMM:PFM   1->539 PF10079 * DUF2317 6.4e-192 41.7 539/542  
:BLT:SWISS 1->539 YLLA_BACSU 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13385.2 GT:GENE yllA GT:PRODUCT putative nucleoid associated protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1578376..1579995 GB:FROM 1578376 GB:TO 1579995 GB:DIRECTION + GB:GENE yllA GB:PRODUCT putative nucleoid associated protein GB:FUNCTION 16.9: Replicate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 16169927; Product type pf : putative factor GB:PROTEIN_ID CAB13385.2 GB:DB_XREF InterPro:IPR011199 SubtiList:BG11424 UniProtKB/Swiss-Prot:P55342 GB:GENE:GENE yllA LENGTH 539 SQ:AASEQ MQLTELSIKNQNVFVQHYIDGKEEMSSFFDYSIHHKDMWRERLEDLSSRFFAREELAAYLTSYHNKFGSSAMQSAIEKLKDPSSAAVVGGQQAGLLTGPLYTIHKIISIIVLAKQQEKELQVPVIPIFWVAGEDHDLDEINFVHTSEENGPVKKKLPQSYWKKSSAASTSLDQEKCAAWIDDVFAAFEETDHTNTLLDNVKRCLRESVTFTDFFELLIADLFQEEGLVLLNSGDPGIKKLETAMFQKILRENDELARAVSDQQAFMRQAGYKPIIESGKEQANLFYEYEDERFLIEKDNGRFVIKELDLGWTRDELHTHMEEHPERFSNNVVTRPLMQEFLIPTLAFIAGPGEINYWGELKQAFAVMGFKMPPVMPRLNITILERHIEKKLAERNISLQDAIERGTENQRETYFERQIPEEFTAVMDQAKSQIEAIHKTVRQEALKVDQSLEPLLLKNAAFIQDQLQFLERTVMKRIEEKEGYVLKDYERIQNSIKPLLAPQERIWNIMYYLNRYGPKFFTTFKNLPFSFQNQHQVVKL GT:EXON 1|1-539:0| SW:ID YLLA_BACSU SW:DE RecName: Full=UPF0747 protein yllA; SW:GN Name=yllA; OrderedLocusNames=BSU15120; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->539|YLLA_BACSU|0.0|100.0|539/539| RP:PFM:NREP 1 RP:PFM:REP 1->539|PF10079|e-125|44.8|538/540|DUF2317| HM:PFM:NREP 1 HM:PFM:REP 1->539|PF10079|6.4e-192|41.7|539/542|DUF2317| OP:NHOMO 92 OP:NHOMOORG 92 OP:PATTERN -------------------------------------------------------------------- 111------------------------------------------------------------------------------------------------11111111111---------------11111111111-----------------------------------------------11-11---1111111111111111111111111111111111------1111111111111111111111--------------------------------------------------------------------------------------------------1--1----1---11--------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 539-540| PSIPRED cccEEEccccccHHHHHHcccHHHHccHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccHHHccEEEEEcccEEEEEEcccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEccEEEEEEcccccEEEccccEEccHHHHHHHHHHcHHHccccccHHHHHHHHHHHHHEEEEccHHHHHHHHHHHHHHHcccccccEEEccEEEEEcHHHHHHHHHHcccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHcHHHHHHHHHHcccHHHHHHcccccccccEEEEEc //