[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ylxY
DDBJ      :ylxY         putative sugar deacetylase
Swiss-Prot:YLXY_BACSU   RecName: Full=Uncharacterized protein ylxY;Flags: Precursor;

Homologs  Archaea  3/68 : Bacteria  304/915 : Eukaryota  80/199 : Viruses  0/175   --->[See Alignment]
c.6.2
:319 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   120->317 1w17A PDBj 4e-31 31.8 %
:RPS:PDB   128->316 2cc0A PDBj 8e-41 24.1 %
:RPS:SCOP  119->314 1ny1A  c.6.2.3 * 1e-52 31.6 %
:HMM:SCOP  88->317 1ny1A_ c.6.2.3 * 2.2e-56 32.6 %
:RPS:PFM   147->246 PF01522 * Polysacc_deac_1 1e-20 38.8 %
:HMM:PFM   125->244 PF01522 * Polysacc_deac_1 3.7e-31 28.6 119/124  
:HMM:PFM   38->93 PF12229 * PG_binding_4 3e-05 19.6 56/114  
:BLT:SWISS 1->319 YLXY_BACSU e-178 100.0 %
:PROS 1->44|PS00430|TONB_DEPENDENT_REC_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13543.1 GT:GENE ylxY GT:PRODUCT putative sugar deacetylase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1741618..1742577 GB:FROM 1741618 GB:TO 1742577 GB:DIRECTION + GB:GENE ylxY GB:PRODUCT putative sugar deacetylase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 14679227; Product type pe : putative enzyme GB:PROTEIN_ID CAB13543.1 GB:DB_XREF GOA:P50850 InterPro:IPR014228 SubtiList:BG11492 UniProtKB/Swiss-Prot:P50850 GB:GENE:GENE ylxY LENGTH 319 SQ:AASEQ MYKKFVPFAVFLFLFFVSFEMMENPHALDYIGAMKKDTVTVTASKDPLYEELLQKAPEYEVKPQNARIDKVWKSIPGYNGLKVNIEQSYKKMKQHGKFREKDLVYSQVKPSVHLESLQPEPIYKGNPDKPMVAFLINVAWGNEYLEKMLPILQKHQVKATFFLEGNWVRNNVQLAKKIAKDGHEIGNHSYNHPDMSKLTTGRISEQLDKTNEQIEQTIGVKPKWFAPPSGSFRKAVIDIAAEKQMGTVMWTVDTIDWQKPAPSVLQTRVLSKIHNGAMILMHPTDPTAESLEALITQIKDKGYALGTVTELMDETRLLK GT:EXON 1|1-319:0| SW:ID YLXY_BACSU SW:DE RecName: Full=Uncharacterized protein ylxY;Flags: Precursor; SW:GN Name=ylxY; Synonyms=ymxI; OrderedLocusNames=BSU16700; SW:KW Complete proteome; Hydrolase; Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->319|YLXY_BACSU|e-178|100.0|319/319| GO:SWS:NREP 1 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| PROS 1->44|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| TM:NTM 1 TM:REGION 5->27| SEG 5->19|fvpfavflflffvsf| BL:PDB:NREP 1 BL:PDB:REP 120->317|1w17A|4e-31|31.8|198/235| RP:PDB:NREP 1 RP:PDB:REP 128->316|2cc0A|8e-41|24.1|187/192| RP:PFM:NREP 1 RP:PFM:REP 147->246|PF01522|1e-20|38.8|98/123|Polysacc_deac_1| HM:PFM:NREP 2 HM:PFM:REP 125->244|PF01522|3.7e-31|28.6|119/124|Polysacc_deac_1| HM:PFM:REP 38->93|PF12229|3e-05|19.6|56/114|PG_binding_4| GO:PFM:NREP 2 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01522|IPR002509| GO:PFM GO:0016810|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds"|PF01522|IPR002509| RP:SCP:NREP 1 RP:SCP:REP 119->314|1ny1A|1e-52|31.6|196/235|c.6.2.3| HM:SCP:REP 88->317|1ny1A_|2.2e-56|32.6|230/0|c.6.2.3|1/1|Glycoside hydrolase/deacetylase| OP:NHOMO 1039 OP:NHOMOORG 387 OP:PATTERN --------------------------------------------------111--------------- 232-711-------21111-11111111111111111---1222-1--1---13------1121-1-6753-222----211------1112-111----1221-112----------------------------12222111-1322122-21--------1-113352------------131--11-556A9A9AABB8AAABCA656685AAC54676231111129B--------------------1-1--------------1-----11211111111--111111111111111111111111111---111123555666656645449553333633--71142446533353322321--2--1---------1122--112221--------------1--2---11-111-221112--43----1------1--------------2--11-----------------------1111--1--1------11-----------2-----------------------------1-----------------1---2-------1--1111-1------------1-1--------------------------------11----------------------1-------------------------------------------------------------------------------------------------------------1------------------------------1-----------------------------------------22122222221111---------------------------------------------------1-1111-1 ------------BB5121122221422------41311-1111---21124425434-222311111111211-1-221211-111---31229842223372ODS-----------------------------------------------------------------------------------2-1--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 269 STR:RPRED 84.3 SQ:SECSTR ################################################EEEEEEEcccccccTTccccTTHHHHHHHHHHTHHHHHHHHHHcccccEcccccccccTTcccccccGGccTTcccccTccEEEEEEEEcccccTTHHHHHHHHHHTTcccEEEEcHHHHHHcHHHHHHHHHTTcEEEEcccccccGGGccHHHHHHHHHHHHHHHHHTTcccccEEccGGGcccHHHHHHHHHTTcEEccccEEccGGGTccHHHHcHHHHHTccTTcEEEEEcccHHHHHHHHHHHHHHHTTEEEcEEcTTTccEEc## DISOP:02AL 33-57| PSIPRED cccEEEHHHHHHHHHHHHHHHccccccccccHHcccccccHHHHHHHHHHHHcccccccEEcccccHHHHHHHHccccccccccHHHHHHHccccccccHHHHHHHcccccccccccccccEEEccccccEEEEEEEcccccccHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHcccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEHHHHHccccccc //