[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ymaD
DDBJ      :ymaD         putative peroxiredoxin-related protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.227.1
:150 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->144 3i07B PDBj 6e-08 27.5 %
:RPS:PDB   6->145 3eerA PDBj 6e-23 19.7 %
:RPS:SCOP  4->139 2onfA1  d.227.1.1 * 5e-29 23.1 %
:HMM:SCOP  4->145 1ukkA_ d.227.1.1 * 6.7e-30 39.6 %
:RPS:PFM   39->141 PF02566 * OsmC 8e-14 38.1 %
:HMM:PFM   39->141 PF02566 * OsmC 1.7e-19 31.6 98/99  
:BLT:SWISS 14->142 Y3023_ACIAD 8e-08 27.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13612.1 GT:GENE ymaD GT:PRODUCT putative peroxiredoxin-related protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1864225..1864677 GB:FROM 1864225 GB:TO 1864677 GB:DIRECTION + GB:GENE ymaD GB:PRODUCT putative peroxiredoxin-related protein GB:FUNCTION 16.8: Protect 16.6: Maintain GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 16267290; Product type pe : putative enzyme GB:PROTEIN_ID CAB13612.1 GB:DB_XREF GOA:O31790 InterPro:IPR019905 SubtiList:BG13412 UniProtKB/TrEMBL:O31790 GB:GENE:GENE ymaD LENGTH 150 SQ:AASEQ MADHHFYLKANWPGNRNDVGTIESGNLITSISIPKEMDGPGEGTNPDEMLLGAAATCYIITLAAMMERSGLEKEDLQMESEGIVNVTKGVFTYKKIIHRPSVVLKHDASQDDVALAHKLCKKAESSCMISRAIQGNVELQLEASVKLGGE GT:EXON 1|1-150:0| BL:SWS:NREP 1 BL:SWS:REP 14->142|Y3023_ACIAD|8e-08|27.5|120/143| BL:PDB:NREP 1 BL:PDB:REP 6->144|3i07B|6e-08|27.5|131/148| RP:PDB:NREP 1 RP:PDB:REP 6->145|3eerA|6e-23|19.7|132/138| RP:PFM:NREP 1 RP:PFM:REP 39->141|PF02566|8e-14|38.1|97/99|OsmC| HM:PFM:NREP 1 HM:PFM:REP 39->141|PF02566|1.7e-19|31.6|98/99|OsmC| GO:PFM:NREP 1 GO:PFM GO:0006950|"GO:response to stress"|PF02566|IPR003718| RP:SCP:NREP 1 RP:SCP:REP 4->139|2onfA1|5e-29|23.1|130/139|d.227.1.1| HM:SCP:REP 4->145|1ukkA_|6.7e-30|39.6|134/141|d.227.1.1|1/1|OsmC-like| OP:NHOMO 41 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------1-1111---1--1111--------11111111111111111111-----------------------111----------------------------------------------------------------------------------------------------1------------1----------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------11-1-------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 95.3 SQ:SECSTR ###ccccccEEEccTTcEEEEETTcccEEEEcccGGTTcccccccHHHHHHHHHHHHHHHHHHHHHHHTTcccccccEEEEEEEEEcccccEEEEEEEcEEEEEcccccHHHHHHHHHHHHHHHHHcHHHHHHTTTcccEEEETTE#### DISOP:02AL 1-2, 149-150| PSIPRED ccccEEEEEEEEEEccEEEEEEcccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEccccccEEEEEEEEEEEEEEEEcccccHHHHHHHHHHHHccccEEEEEcccEEEEEEEEEEEccc //