[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ymxH
DDBJ      :ymxH         conserved hypothetical protein
Swiss-Prot:YMXH_BACSU   RecName: Full=Uncharacterized protein ymxH;AltName: Full=ORFZ;

Homologs  Archaea  0/68 : Bacteria  44/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.41.1
:85 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->79 1pm3A PDBj 9e-04 35.4 %
:RPS:PDB   1->80 3bl4B PDBj 8e-06 15.3 %
:RPS:SCOP  1->78 1pm3A  b.41.1.2 * 3e-07 26.9 %
:HMM:SCOP  1->79 1pm3A_ b.41.1.2 * 2.7e-11 37.3 %
:HMM:PFM   1->80 PF05239 * PRC 1.3e-18 32.0 75/79  
:BLT:SWISS 1->85 YMXH_BACSU 2e-46 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13545.1 GT:GENE ymxH GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1743924..1744181 GB:FROM 1743924 GB:TO 1744181 GB:DIRECTION + GB:GENE ymxH GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13545.1 GB:DB_XREF GOA:Q04811 InterPro:IPR014238 SubtiList:BG10780 UniProtKB/Swiss-Prot:Q04811 GB:GENE:GENE ymxH LENGTH 85 SQ:AASEQ MRLSELSGKEIVDIKRAERLGVLGQTDLEINEQDGQITALLIPTVKWFGLRKQGHDIRVPWHHIQKIGSDMIILDVPEEMPPRQE GT:EXON 1|1-85:0| SW:ID YMXH_BACSU SW:DE RecName: Full=Uncharacterized protein ymxH;AltName: Full=ORFZ; SW:GN Name=ymxH; OrderedLocusNames=BSU16720; SW:KW Complete proteome; Sporulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->85|YMXH_BACSU|2e-46|100.0|85/85| GO:SWS:NREP 1 GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| BL:PDB:NREP 1 BL:PDB:REP 3->79|1pm3A|9e-04|35.4|65/69| RP:PDB:NREP 1 RP:PDB:REP 1->80|3bl4B|8e-06|15.3|72/109| HM:PFM:NREP 1 HM:PFM:REP 1->80|PF05239|1.3e-18|32.0|75/79|PRC| RP:SCP:NREP 1 RP:SCP:REP 1->78|1pm3A|3e-07|26.9|67/69|b.41.1.2| HM:SCP:REP 1->79|1pm3A_|2.7e-11|37.3|75/78|b.41.1.2|1/1|PRC-barrel domain| OP:NHOMO 47 OP:NHOMOORG 44 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111221111111111-1--------1--------------------------------------------------------------------------------------------11------------11--------------11--1111--21--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 94.1 SQ:SECSTR EEEEccccccccHHHTHHHHHHHEEHHHHTTccccEEEcccHHHHHHHEEEccHHHHHcccccccEEEcccGGGHHHHHH##### DISOP:02AL 80-85| PSIPRED cccHHcccccEEEccccEEEEcccccEEEEEccccEEEEEEEccccEEcccccccEEEEcHHHcEEEccEEEEEEcccccccccc //