[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ymzA
DDBJ      :ymzA         conserved hypothetical protein
Swiss-Prot:YMZA_BACSU   RecName: Full=Uncharacterized protein ymzA;

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   40->63 PF09684 * Tail_P2_I 0.00062 50.0 24/139  
:BLT:SWISS 1->76 YMZA_BACSU 4e-41 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13620.1 GT:GENE ymzA GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1868144..1868374 GB:FROM 1868144 GB:TO 1868374 GB:DIRECTION + GB:GENE ymzA GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13620.1 GB:DB_XREF SubtiList:BG13434 UniProtKB/Swiss-Prot:O31798 GB:GENE:GENE ymzA LENGTH 76 SQ:AASEQ MKHKVIVNHWEEICEDDSCYEYGTSIIVNGKELIREASIITALKAVLEEIGADVEIEETVESEKCCDSLRKKNLDY GT:EXON 1|1-76:0| SW:ID YMZA_BACSU SW:DE RecName: Full=Uncharacterized protein ymzA; SW:GN Name=ymzA; OrderedLocusNames=BSU17360; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->76|YMZA_BACSU|4e-41|100.0|76/100| HM:PFM:NREP 1 HM:PFM:REP 40->63|PF09684|0.00062|50.0|24/139|Tail_P2_I| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 74-76| PSIPRED ccccEEEccHHHHcccccHHHHccEEEEcHHHHHHHHHHHHHHHHHHHHHcccccHHHHHccHHHHHHHHHccccc //