[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ymzC
DDBJ      :ymzC         hypothetical protein
Swiss-Prot:YMZC_BACSU   RecName: Full=Uncharacterized protein ymzC;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:90 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->35 PF10939 * DUF2631 0.00047 35.5 31/65  
:HMM:PFM   27->68 PF07691 * PA14 0.00027 19.0 42/145  
:BLT:SWISS 1->90 YMZC_BACSU 2e-50 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13619.1 GT:GENE ymzC GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1867790..1868062 GB:FROM 1867790 GB:TO 1868062 GB:DIRECTION + GB:GENE ymzC GB:PRODUCT hypothetical protein GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB13619.1 GB:DB_XREF SubtiList:BG13436 UniProtKB/Swiss-Prot:O31797 GB:GENE:GENE ymzC LENGTH 90 SQ:AASEQ MFESEAELRRIRIALVWIAVFLLFGACGNQDTIIETDNGNSDYETPQPTSFPLEHNHFGVMEDGYIKIYEYNESRNEVKLKKEYADDELE GT:EXON 1|1-90:0| SW:ID YMZC_BACSU SW:DE RecName: Full=Uncharacterized protein ymzC;Flags: Precursor; SW:GN Name=ymzC; OrderedLocusNames=BSU17350; SW:KW Complete proteome; Signal. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->90|YMZC_BACSU|2e-50|100.0|90/100| HM:PFM:NREP 2 HM:PFM:REP 5->35|PF10939|0.00047|35.5|31/65|DUF2631| HM:PFM:REP 27->68|PF07691|0.00027|19.0|42/145|PA14| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 86-90| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHccccccccEEEcccccccccccccccccccccccccccccEEEEEEEcccccEEEEEccccccccc //