[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ynaD
DDBJ      :ynaD         putative N-acetyltransferase
Swiss-Prot:YNAD_BACSU   RecName: Full=Uncharacterized N-acetyltransferase ynaD;         EC=2.3.1.-;

Homologs  Archaea  15/68 : Bacteria  342/915 : Eukaryota  18/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:170 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->168 3fbuB PDBj 1e-81 82.5 %
:RPS:PDB   4->169 3eg7B PDBj 8e-24 21.7 %
:RPS:SCOP  1->165 2fckA1  d.108.1.1 * 3e-39 21.3 %
:HMM:SCOP  1->166 2fckA1 d.108.1.1 * 4.9e-51 35.5 %
:RPS:PFM   80->139 PF00583 * Acetyltransf_1 7e-04 30.5 %
:HMM:PFM   64->141 PF00583 * Acetyltransf_1 5.6e-15 20.8 77/83  
:BLT:SWISS 1->170 YNAD_BACSU e-103 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13636.1 GT:GENE ynaD GT:PRODUCT putative N-acetyltransferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1883166..1883678 GB:FROM 1883166 GB:TO 1883678 GB:DIRECTION + GB:GENE ynaD GB:PRODUCT putative N-acetyltransferase GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB13636.1 GB:DB_XREF GOA:P94482 InterPro:IPR000182 SubtiList:BG12256 UniProtKB/Swiss-Prot:P94482 GB:GENE:GENE ynaD LENGTH 170 SQ:AASEQ MHITTKRLLIREFEFKDWQAVYEYTSDSNVMKYIPEGVFTEEDAKAFVNKNKGDNAEKFPVILRDEDCLIGHIVFYKYFGEHTYEIGWVFNPNYQNKGYASEAAQAILEYGFKEMNLHRIIATCQPENIPSYRVMKKIGMRREGFFKKCIPKGNEWWDEYYYAILEEEWN GT:EXON 1|1-170:0| SW:ID YNAD_BACSU SW:DE RecName: Full=Uncharacterized N-acetyltransferase ynaD; EC=2.3.1.-; SW:GN Name=ynaD; OrderedLocusNames=BSU17520; SW:KW Acyltransferase; Complete proteome; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->170|YNAD_BACSU|e-103|100.0|170/170| GO:SWS:NREP 2 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 1->168|3fbuB|1e-81|82.5|166/166| RP:PDB:NREP 1 RP:PDB:REP 4->169|3eg7B|8e-24|21.7|166/172| RP:PFM:NREP 1 RP:PFM:REP 80->139|PF00583|7e-04|30.5|59/80|Acetyltransf_1| HM:PFM:NREP 1 HM:PFM:REP 64->141|PF00583|5.6e-15|20.8|77/83|Acetyltransf_1| GO:PFM:NREP 2 GO:PFM GO:0008080|"GO:N-acetyltransferase activity"|PF00583|IPR000182| GO:PFM GO:0008152|"GO:metabolic process"|PF00583|IPR000182| RP:SCP:NREP 1 RP:SCP:REP 1->165|2fckA1|3e-39|21.3|164/174|d.108.1.1| HM:SCP:REP 1->166|2fckA1|4.9e-51|35.5|166/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 818 OP:NHOMOORG 375 OP:PATTERN ------------------------1111-1-------------1-111--111----211-------- -1--2--------------------------------2---1--11-2111-11121---12212121312---------1---------31-3-----2-222-5---1------------------------1------1114-11----2-------------22231------------1-1-------499999FDC5B9ADCD464474ABA1-1B153222223532--------1----1-21-11--2--2--------11---42-32332312223--22222222222-------------311---111--33-42222232121112221--411----3--54---1----2-2-111--12----1---21123111-112111111111112--------1212-3332113-1-33-1--21--1-22--1-------------141------------------------------1-1--1----1222212--------11111-1--1----1-------------1-------3--------------1---------1---------------------1--------------------1-----11--11211--3323342253334223343------------------3-------------------------------322-122211111111111111113---------2--------------2-----1421--1-1--------------1221221--1---21-2111-2-111-223----------1112312211-12111---------------3----11--------2-1------------------1------13--1-----1-1 ----31-------1111---11---------------------------1-1-1-----111------------------------------1----------------------------------------------------------------------1---------------------1--------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 170 STR:RPRED 100.0 SQ:SECSTR EEEHHHTcEEEEccGGGHHHHHHHTTTTccEEETTEEEccHHHHHHHHHHHTTccccEEEEEEcTTccEEEEEEEEEETTTTEEEEEEEEcGGGTTccHHHHHHHHHHHHHHHTccccEEEEEEETTcHHHHHHHHHTTcEEEEEEEEEEEETTEEEEEEEEEEHHHHHH PSIPRED cEEEccEEEEEEccHHHHHHHHHHHccHHHHHHcccccccHHHHHHHHHHHHcccccEEEEEEEcccEEEEEEEEEEcccccEEEEEEEEcHHHccccHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHcccEEEEEEEccEEEccEEEEEEEEEEEHHHcc //