[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ynaE
DDBJ      :ynaE         conserved hypothetical protein
Swiss-Prot:YNAE_BACSU   RecName: Full=Uncharacterized protein ynaE;

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:213 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->73 2rfbC PDBj 4e-04 36.0 %
:HMM:PFM   8->81 PF12495 * Vip3A_N 0.00041 26.4 72/177  
:BLT:SWISS 1->213 YNAE_BACSU e-128 100.0 %
:PROS 24->33|PS00086|CYTOCHROME_P450

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13637.1 GT:GENE ynaE GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1884238..1884879 GB:FROM 1884238 GB:TO 1884879 GB:DIRECTION + GB:GENE ynaE GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13637.1 GB:DB_XREF SubtiList:BG12257 UniProtKB/Swiss-Prot:P94483 GB:GENE:GENE ynaE LENGTH 213 SQ:AASEQ MNLIGYIEERFQNLELIPSIYNQWGTGIHFCLGENIYQLKANEELNLKMFRIVYEQTSIIFNELFEQNDDIFLVTNMYKHKKKEKCIRKLKVYQPFLKCKNHLNQIMVKTYPYPFEINKAEEYEMQQFSLLCKPRDLRVTELLKAASNEDFPQKPKFGGYSIDYPDVFFVNITKDIIFFIYDDRGCEVIAHDFKRIRPLYEKYHDWVEEYKCM GT:EXON 1|1-213:0| SW:ID YNAE_BACSU SW:DE RecName: Full=Uncharacterized protein ynaE; SW:GN Name=ynaE; OrderedLocusNames=BSU17530; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->213|YNAE_BACSU|e-128|100.0|213/100| PROS 24->33|PS00086|CYTOCHROME_P450|PDOC00081| BL:PDB:NREP 1 BL:PDB:REP 24->73|2rfbC|4e-04|36.0|50/333| HM:PFM:NREP 1 HM:PFM:REP 8->81|PF12495|0.00041|26.4|72/177|Vip3A_N| OP:NHOMO 39 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------122212-11-112131----11221---1111-----------1111-11---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 50 STR:RPRED 23.5 SQ:SECSTR #######################TcccTTccTTHHHHHHHHHHHHHcccccccTTTcEEcccTTcccEEEccc############################################################################################################################################ DISOP:02AL 213-214| PSIPRED ccHHHHHHHHccccEEEEccccccccEEEEEccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEcccccccccEEEccHHHHHcccccccEEEccccEEEcccccccEEEEEEEEcccHHHccHHHHHHHHHHcccccccccccccccccEEEEEEccccEEEEEEcccccEEEEEcHHHHHHHHHHHHHHHHccccc //