[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ynaG
DDBJ      :ynaG         conserved hypothetical protein
Swiss-Prot:YNAG_BACSU   RecName: Full=Uncharacterized protein ynaG;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   48->79 PF05313 * Pox_P21 0.00034 31.2 32/190  
:BLT:SWISS 1->91 YNAG_BACSU 5e-42 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13639.1 GT:GENE ynaG GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1885365..1885640 GB:FROM 1885365 GB:TO 1885640 GB:DIRECTION + GB:GENE ynaG GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13639.1 GB:DB_XREF GOA:P94485 SubtiList:BG12259 UniProtKB/Swiss-Prot:P94485 GB:GENE:GENE ynaG LENGTH 91 SQ:AASEQ MNVKKAAAVFSITIPIISAILIINFFTGFMSIPWQGMPVFFPLLLSPIGIILAFVSIKTNKRCAVYGIVLNAIMFPFPFFWFIGGALLFGV GT:EXON 1|1-91:0| SW:ID YNAG_BACSU SW:DE RecName: Full=Uncharacterized protein ynaG; SW:GN Name=ynaG; OrderedLocusNames=BSU17550; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->91|YNAG_BACSU|5e-42|100.0|91/100| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 3 TM:REGION 7->29| TM:REGION 36->57| TM:REGION 66->88| SEG 12->23|itipiisailii| HM:PFM:NREP 1 HM:PFM:REP 48->79|PF05313|0.00034|31.2|32/190|Pox_P21| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //