[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ynxB
DDBJ      :ynxB         putative phage protein
Swiss-Prot:YNXB_BACSU   RecName: Full=Uncharacterized protein ynxB;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->45 PF09925 * DUF2157 0.00063 28.6 35/145  
:BLT:SWISS 1->96 YNXB_BACSU 4e-49 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13631.1 GT:GENE ynxB GT:PRODUCT putative phage protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1880087..1880377 GB:FROM 1880087 GB:TO 1880377 GB:DIRECTION + GB:GENE ynxB GB:PRODUCT putative phage protein GB:FUNCTION 16.5: Explore GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type h: extrachromosomal origin GB:PROTEIN_ID CAB13631.1 GB:DB_XREF SubtiList:BG11074 UniProtKB/Swiss-Prot:P31844 GB:GENE:GENE ynxB LENGTH 96 SQ:AASEQ MKKLTIFSGGLGAVFSVLAQLFAVIDDSYTLGNLWFLGALAGIITMLASIQTNNKPVFSILLIASSVIGLLGTGLVYIIPTLFNIIIIYKFSKVSQ GT:EXON 1|1-96:0| SW:ID YNXB_BACSU SW:DE RecName: Full=Uncharacterized protein ynxB; SW:GN Name=ynxB; Synonyms=ynaA; OrderedLocusNames=BSU17470; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->96|YNXB_BACSU|4e-49|100.0|96/100| TM:NTM 3 TM:REGION 5->27| TM:REGION 31->53| TM:REGION 63->85| HM:PFM:NREP 1 HM:PFM:REP 11->45|PF09925|0.00063|28.6|35/145|DUF2157| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 95-96| PSIPRED ccEEEEEcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //