[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yoaG
DDBJ      :yoaG         putative permease
Swiss-Prot:YOAG_BACSU   RecName: Full=UPF0715 membrane protein yoaG;

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:134 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->122 PF06570 * DUF1129 5.1e-05 17.9 112/205  
:BLT:SWISS 1->134 YOAG_BACSU 1e-43 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13752.1 GT:GENE yoaG GT:PRODUCT putative permease GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2028175..2028579) GB:FROM 2028175 GB:TO 2028579 GB:DIRECTION - GB:GENE yoaG GB:PRODUCT putative permease GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pm: putative membrane component GB:PROTEIN_ID CAB13752.1 GB:DB_XREF GOA:O31830 SubtiList:BG13478 UniProtKB/Swiss-Prot:O31830 GB:GENE:GENE yoaG LENGTH 134 SQ:AASEQ MKKIASYYLMTLGLSSLTFGLLLGFYSFVMYGDMIIALFTAAIALLYGFVVYGLFAVPLQMKLQKKARTFNVMYLLIYSVVAFIAAFLFFVINEPASIAWTLQSYFYYMLSIAAAVIYWLWDSLILYKRTASGV GT:EXON 1|1-134:0| SW:ID YOAG_BACSU SW:DE RecName: Full=UPF0715 membrane protein yoaG; SW:GN Name=yoaG; OrderedLocusNames=BSU18590; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->134|YOAG_BACSU|1e-43|100.0|134/134| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 6->28| TM:REGION 37->59| TM:REGION 72->94| TM:REGION 105->127| SEG 9->28|lmtlglssltfglllgfysf| SEG 35->46|iialftaaiall| SEG 80->92|vvafiaaflffvi| HM:PFM:NREP 1 HM:PFM:REP 9->122|PF06570|5.1e-05|17.9|112/205|DUF1129| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 1-3, 133-134| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //