[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yoaP
DDBJ      :yoaP         conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1d.108.1
:251 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   49->145 2a6aB PDBj 3e-07 6.4 %
:RPS:PDB   166->251 2ct6A PDBj 1e-06 12.8 %
:RPS:SCOP  33->139 1cm0A  d.108.1.1 * 6e-07 11.3 %
:RPS:SCOP  157->240 1wikA  c.47.1.1 * 2e-04 17.5 %
:HMM:SCOP  1->139 1y9wA1 d.108.1.1 * 7.5e-08 20.3 %
:HMM:SCOP  174->248 1wjkA_ c.47.1.1 * 1e-06 21.6 %
:HMM:PFM   57->135 PF00583 * Acetyltransf_1 2.9e-12 23.3 73/83  
:HMM:PFM   176->220 PF04134 * DUF393 0.00025 33.3 45/113  
:HMM:PFM   12->40 PF06941 * NT5C 0.00022 27.6 29/191  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13761.1 GT:GENE yoaP GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2039610..2040365) GB:FROM 2039610 GB:TO 2040365 GB:DIRECTION - GB:GENE yoaP GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB13761.1 GB:DB_XREF GOA:O34983 InterPro:IPR000182 SubtiList:BG13486 UniProtKB/TrEMBL:O34983 GB:GENE:GENE yoaP LENGTH 251 SQ:AASEQ MCYIEITKDNIEDNHICCALSTKQYEHAVNEKKRWLKARMDEGLVFYRLHERAKVFIEYLPANEAWVPINAPNFMYINCLWVSGRYKNNGHAKRLLDKCIADAKACGMDGIIHIAGKKKLPYLSDKHFFEHMGFTLQDEAAPYFQLMALTWNGLADSPAFKSQVKSDSINEKGITIYYTAQCPFAVGMINDLRELTEKKGVQFQSIQLSSKEEAQKSPAIWTTFSVFFDGRFVTHEIMSINKFEKLLNTLA GT:EXON 1|1-251:0| RP:PDB:NREP 2 RP:PDB:REP 49->145|2a6aB|3e-07|6.4|94/186| RP:PDB:REP 166->251|2ct6A|1e-06|12.8|86/111| HM:PFM:NREP 3 HM:PFM:REP 57->135|PF00583|2.9e-12|23.3|73/83|Acetyltransf_1| HM:PFM:REP 176->220|PF04134|0.00025|33.3|45/113|DUF393| HM:PFM:REP 12->40|PF06941|0.00022|27.6|29/191|NT5C| RP:SCP:NREP 2 RP:SCP:REP 33->139|1cm0A|6e-07|11.3|97/162|d.108.1.1| RP:SCP:REP 157->240|1wikA|2e-04|17.5|80/109|c.47.1.1| HM:SCP:REP 1->139|1y9wA1|7.5e-08|20.3|123/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| HM:SCP:REP 174->248|1wjkA_|1e-06|21.6|74/0|c.47.1.1|1/1|Thioredoxin-like| OP:NHOMO 23 OP:NHOMOORG 21 OP:PATTERN --------------------------------------------------1-1--------------- -----------------------------------------------------------------------2--------1---------2-------------------------------------------1----------------------------------------------------------1--------------------1----------------1--------------------------------------------------------------------------------------------1---1111111-1----------1--------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 250 STR:RPRED 99.6 SQ:SECSTR EEHHHHHHHHTTTcTTTccccHHHHHHHHTcTTccEEEEEGGGEEEEEHHHHHTTTTccEEEEEHHHEEEETTEEEEEEEEEcccEEEEEEEEEEEHHHHHHHHHHHcccEEEEccccccHHHTTHHHHHHHHHHHHTccccGGGEEEEETTGGG#ccHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHHHTTccEEEEETTTcHHHHHHHHHccccEEEETTEEEEHHHHHHHTTTcHHHHHT PSIPRED cEEEEccHHHHHHccccEEEEccccccHHHHHHHHHHHHcccccEEEEEEEcccEEEEEEEcccEEEEEEcccEEEEEEEEEccccccccHHHHHHHHHHHHHHHccccEEEEEEEEcccccccccHHHHHcccEEccccccccEEEEEEcccccccHHHHHHccccEEccccEEEEEcccccccHHHHHHHHHHHHHcccccEEEEEccHHHHHccccccEEEEEEEccEEEEEccccHHHHHHHHHHHc //