[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yoaW
DDBJ      :yoaW         biofilm forming exported protein
Swiss-Prot:YOAW_BACSU   RecName: Full=Uncharacterized protein yoaW;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:143 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   18->91 PF10626 * TraO 0.00021 21.6 74/193  
:HMM:PFM   80->113 PF12539 * Csm1 0.00041 29.4 34/90  
:BLT:SWISS 17->143 YOAW_BACSU 3e-75 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13770.1 GT:GENE yoaW GT:PRODUCT biofilm forming exported protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2046980..2047411) GB:FROM 2046980 GB:TO 2047411 GB:DIRECTION - GB:GENE yoaW GB:PRODUCT biofilm forming exported protein GB:FUNCTION 16.5: Explore GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15101989; Product type ph: phenotype GB:PROTEIN_ID CAB13770.1 GB:DB_XREF SubtiList:BG13493 UniProtKB/Swiss-Prot:O34541 GB:GENE:GENE yoaW LENGTH 143 SQ:AASEQ MKKMLMLAFTFLLALTIHVGEASAVIVKDEEKVSFTMTENEKWFMKSDDLNSNHWTSHFGYRFTIFDTEGCTINARIMRMTLSGYEITVSEKNFSGDHFDFSATDRVETMPYKTHYLILTKDPDCGDVKVKGLYGFQFDQPEW GT:EXON 1|1-143:0| SW:ID YOAW_BACSU SW:DE RecName: Full=Uncharacterized protein yoaW;Flags: Precursor; SW:GN Name=yoaW; OrderedLocusNames=BSU18780; SW:KW Complete proteome; Signal. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 17->143|YOAW_BACSU|3e-75|100.0|127/100| TM:NTM 1 TM:REGION 5->27| SEG 2->16|kkmlmlaftfllalt| HM:PFM:NREP 2 HM:PFM:REP 18->91|PF10626|0.00021|21.6|74/193|TraO| HM:PFM:REP 80->113|PF12539|0.00041|29.4|34/90|Csm1| OP:NHOMO 5 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------------11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 142-143| PSIPRED ccHHHHHHHHHHHHHEEEEccccEEEEEcccEEEEEEEcccEEEEEEccccccEEEEEEEEEEEEEcccccEEEEEEEEEEEEcEEEEEEcccccccEEEEEEccccccccccEEEEEEEEccccccEEEEEEEEEEcccccc //