[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yobE
DDBJ      :yobE         putative phage protein
Swiss-Prot:YOBE_BACSU   RecName: Full=UPF0361 protein yobE;

Homologs  Archaea  10/68 : Bacteria  305/915 : Eukaryota  132/199 : Viruses  1/175   --->[See Alignment]
d.303.1
:219 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->206 2f20B PDBj 5e-24 38.7 %
:RPS:PDB   2->213 2bdvA PDBj 1e-65 28.1 %
:RPS:SCOP  2->213 2bdvA1  d.303.1.1 * 4e-65 30.2 %
:HMM:SCOP  2->219 2bdvA1 d.303.1.1 * 3.7e-78 42.7 %
:RPS:PFM   1->195 PF02586 * DUF159 3e-45 46.1 %
:HMM:PFM   1->212 PF02586 * DUF159 3.2e-60 42.7 199/208  
:BLT:SWISS 1->219 YOBE_BACSU e-130 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13780.1 GT:GENE yobE GT:PRODUCT putative phage protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2057801..2058460 GB:FROM 2057801 GB:TO 2058460 GB:DIRECTION + GB:GENE yobE GB:PRODUCT putative phage protein GB:FUNCTION 16.5: Explore GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type h: extrachromosomal origin GB:PROTEIN_ID CAB13780.1 GB:DB_XREF InterPro:IPR003738 SubtiList:BG13498 UniProtKB/Swiss-Prot:O34915 GB:GENE:GENE yobE LENGTH 219 SQ:AASEQ MCGKFTLFSEFDDIIEQFNIDQFLPEGEYHPSYNVAPSQNILTIINDGSNNRLGKLRWGLIPPCAKDEKIGYKMINARAETLAEKPSFRKPLGSKRCIIPADSFYEWKRLDPKTKIPMRIKLKSSNLFAFAGLYEKWNTLEGNLLYTCTIITIKPSELMEDIHDRMPVILTDENKKEWLNPKNTDPDYLQSLLLPYDADDMEAYQVSSLVNSPELIESH GT:EXON 1|1-219:0| SW:ID YOBE_BACSU SW:DE RecName: Full=UPF0361 protein yobE; SW:GN Name=yobE; OrderedLocusNames=BSU18880; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->219|YOBE_BACSU|e-130|100.0|219/219| BL:PDB:NREP 1 BL:PDB:REP 13->206|2f20B|5e-24|38.7|181/226| RP:PDB:NREP 1 RP:PDB:REP 2->213|2bdvA|1e-65|28.1|203/210| RP:PFM:NREP 1 RP:PFM:REP 1->195|PF02586|3e-45|46.1|193/204|DUF159| HM:PFM:NREP 1 HM:PFM:REP 1->212|PF02586|3.2e-60|42.7|199/208|DUF159| RP:SCP:NREP 1 RP:SCP:REP 2->213|2bdvA1|4e-65|30.2|202/213|d.303.1.1| HM:SCP:REP 2->219|2bdvA1|3.7e-78|42.7|213/0|d.303.1.1|1/1|BB1717-like| OP:NHOMO 541 OP:NHOMOORG 448 OP:PATTERN ------------------------23311111------------1--1-------------------- 21--11111111--11112-1111111111111111122111111122132-122111--111-1121111----1------1-------1--------1-1--111-----------------1---11---111111-----1-1--1---11--111111---1111-111111111111-----11-------------------1-11-3---111-1--------12------------------------------------------1-----------------------------------------------1-1------------1-------1---1--1--11---1111----1---1-----------11111111111111111111-112-1111121-221-1111342232111111-1-11111112--------211--111------------------------------------3-12------1----------------1-----1--------11-1----1---2----------212-311-------1-------1--1-12----111--------------------------1-----311----2----1------1---------111--------1-----111111111--111111111-111-11---211-----1---1111--1-1--1-111---1-----------------------211---11----------------11121-1---2-11112524222332113----------------------------------------1-11--------------1-----------------------------------1-- ------1-------11111111111-111-1-111111111111111111-11-111-1111---111--11-1111-111111-1---1211111---1-1-1---12--21111111-112-2-12-392-1121-1-1-11---11121131211111--11--1111--11-11-----1111111111--1-1- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ STR:NPRED 212 STR:RPRED 96.8 SQ:SECSTR #cccEEEcccHHHHHHHHcccHHccccccccEEEEcTTcccEEEcTTTTccEEEEcccccccTTcccHHHHHHccEEEHHHHHTTcTTGGGTTTcEEEEEEEEEEEEEEcccccccEEEEEEEEEEEEEEEEEEcccTTccccGGGcEEEEEcGGGcccccTTccccccccHHHHHHHHcTTccHHHHHHHHTccccGGGcEEEEcccccccc###### DISOP:02AL 218-219| PSIPRED ccccccccccHHHHHHHHccccccccccccccccccccccEEEEEEcccccEEEEEEccccccccccccccccEEEEEcccccccHHHHHHHHcccEEEEEEcEEEcccccccccEEEEEEcccccEEEEEEEEcccccccccEEEEEEEEEEcccHHHHHHHccccEEccHHHHHHHcccccccHHHHHHHHcccccccEEEEEcccccccHHHcccc //