[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yoeD
DDBJ      :yoeD         putative excisionase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->68 1xx7F PDBj 2e-04 35.6 %
:HMM:PFM   2->51 PF09035 * Tn916-Xis 2.5e-05 30.0 50/67  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13723.1 GT:GENE yoeD GT:PRODUCT putative excisionase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2004262..2004492) GB:FROM 2004262 GB:TO 2004492 GB:DIRECTION - GB:GENE yoeD GB:PRODUCT putative excisionase GB:FUNCTION 16.5: Explore GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 16880568; Product type pe : putative enzyme GB:PROTEIN_ID CAB13723.1 GB:DB_XREF GOA:O34555 InterPro:IPR010093 SubtiList:BG13551 UniProtKB/TrEMBL:O34555 GB:GENE:GENE yoeD LENGTH 76 SQ:AASEQ MYLTIEETAEYTNLSEDYIKSLVLEGKIRAVHDGEQFLIYKEQFKTHLEQLENYKALVQEILNEPIPEDIDVKDED GT:EXON 1|1-76:0| BL:PDB:NREP 1 BL:PDB:REP 10->68|1xx7F|2e-04|35.6|59/165| HM:PFM:NREP 1 HM:PFM:REP 2->51|PF09035|2.5e-05|30.0|50/67|Tn916-Xis| OP:NHOMO 26 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111--1111111---11--------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 59 STR:RPRED 77.6 SQ:SECSTR #########GGHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHTTccccGGGGTTccGGGcHHHHHH######## DISOP:02AL 70-76| PSIPRED cEEEHHHHHHHccccHHHHHHHHHHccccEEEcccEEEEEHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc //