[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yokJ
DDBJ      :yokJ         conserved hypothetical protein; phage SPbeta
Swiss-Prot:YOKJ_BACSU   RecName: Full=SPBc2 prophage-derived uncharacterized protein yokJ;

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   33->142 3d5pA PDBj 2e-07 22.0 %
:HMM:PFM   32->135 PF09346 * SMI1_KNR4 4.4e-11 26.7 101/130  
:BLT:SWISS 1->165 YOKJ_BACSU 2e-97 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14075.1 GT:GENE yokJ GT:PRODUCT conserved hypothetical protein; phage SPbeta GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2275200..2275697) GB:FROM 2275200 GB:TO 2275697 GB:DIRECTION - GB:GENE yokJ GB:PRODUCT conserved hypothetical protein; phage SPbeta GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB14075.1 GB:DB_XREF InterPro:IPR018958 SubtiList:BG13577 UniProtKB/Swiss-Prot:O31997 GB:GENE:GENE yokJ LENGTH 165 SQ:AASEQ MSIDMLIKKIASTSDCRLFEADGLPVIDEKHQLPKDISEFYEQCGGAVLYENADYPIYIVRPAEFELANPIIVGELCEEDISSEWYIVCTDGKGEYLTIDLNDQRKGKCYDSFFDRHGIVGETQVIASSFTDLIQRLLENKGKHWYWLRDDYVSLGDAYDGIEIE GT:EXON 1|1-165:0| SW:ID YOKJ_BACSU SW:DE RecName: Full=SPBc2 prophage-derived uncharacterized protein yokJ; SW:GN Name=yokJ; OrderedLocusNames=BSU21570; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->165|YOKJ_BACSU|2e-97|100.0|165/100| RP:PDB:NREP 1 RP:PDB:REP 33->142|3d5pA|2e-07|22.0|100/131| HM:PFM:NREP 1 HM:PFM:REP 32->135|PF09346|4.4e-11|26.7|101/130|SMI1_KNR4| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------11---------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ STR:NPRED 100 STR:RPRED 60.6 SQ:SECSTR ################################ccHHHHHHHHHcccEEEEET#TEEEEEccHHHHHHHHH####HHTHHHHccTTEEEEEETTEEEE#EETTTccEEEEETTcccG####GGcEEEEccHHHHHHHHTTccT####################### DISOP:02AL 1-2, 161-165| PSIPRED ccHHHHHHHHccccccEEEcccccccccHHHcccccHHHHHHHHccEEEEEcccEEEEEEcHHHEEEcccEEEEEcccccccccEEEEEEcccccEEEEEEcccccccEEHHHHHHcccccccHHHHHHHHHHHHHHHHccccEEEEEccccHHccccccccccc //