[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yokL
DDBJ      :yokL         putative acetyltransferase; phage SPbeta
Swiss-Prot:YOKL_BACSU   RecName: Full=SPBc2 prophage-derived uncharacterized N-acetyltransferase yokL;         EC=2.3.1.-;

Homologs  Archaea  5/68 : Bacteria  151/915 : Eukaryota  3/199 : Viruses  1/175   --->[See Alignment]
d.108.1
:177 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->161 3eg7F PDBj 6e-13 29.9 %
:RPS:PDB   9->173 3eg7B PDBj 2e-19 21.8 %
:RPS:SCOP  9->167 2fckA1  d.108.1.1 * 2e-20 18.1 %
:HMM:SCOP  1->169 2fckA1 d.108.1.1 * 5.4e-34 29.6 %
:RPS:PFM   91->144 PF00583 * Acetyltransf_1 2e-05 37.7 %
:HMM:PFM   66->143 PF00583 * Acetyltransf_1 1.8e-13 29.9 77/83  
:BLT:SWISS 1->177 YOKL_BACSU e-103 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14073.1 GT:GENE yokL GT:PRODUCT putative acetyltransferase; phage SPbeta GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2273989..2274522) GB:FROM 2273989 GB:TO 2274522 GB:DIRECTION - GB:GENE yokL GB:PRODUCT putative acetyltransferase; phage SPbeta GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB14073.1 GB:DB_XREF GOA:O31995 InterPro:IPR000182 SubtiList:BG13579 UniProtKB/Swiss-Prot:O31995 GB:GENE:GENE yokL LENGTH 177 SQ:AASEQ MAVTYWTGENLTLRAIQPEDIVIFDSLDDEILRNMDSLHFPRSANNMREWVEEQLEKDEFRFIAVESDNNIVGMIETFDCDRKNGTFGYYLAVFEPYRGKGFAKEMILMVLRFFFLELAYQKVNTTVYSFNNPSIRLHEKLGFMKEGQLRKIIFTKGAYYDGICFGMTREEFELNHG GT:EXON 1|1-177:0| SW:ID YOKL_BACSU SW:DE RecName: Full=SPBc2 prophage-derived uncharacterized N-acetyltransferase yokL; EC=2.3.1.-; SW:GN Name=yokL; OrderedLocusNames=BSU21550; SW:KW Acyltransferase; Complete proteome; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->177|YOKL_BACSU|e-103|100.0|177/177| GO:SWS:NREP 2 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 11->161|3eg7F|6e-13|29.9|147/171| RP:PDB:NREP 1 RP:PDB:REP 9->173|3eg7B|2e-19|21.8|165/172| RP:PFM:NREP 1 RP:PFM:REP 91->144|PF00583|2e-05|37.7|53/80|Acetyltransf_1| HM:PFM:NREP 1 HM:PFM:REP 66->143|PF00583|1.8e-13|29.9|77/83|Acetyltransf_1| GO:PFM:NREP 2 GO:PFM GO:0008080|"GO:N-acetyltransferase activity"|PF00583|IPR000182| GO:PFM GO:0008152|"GO:metabolic process"|PF00583|IPR000182| RP:SCP:NREP 1 RP:SCP:REP 9->167|2fckA1|2e-20|18.1|155/174|d.108.1.1| HM:SCP:REP 1->169|2fckA1|5.4e-34|29.6|169/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 253 OP:NHOMOORG 160 OP:PATTERN ------------------------1--1-1----------------------------11-------- ---------------------------------------------1-----1---1----------1--1------------------221--4------1-111---------------------------------------2-1----------------------1-------------1------1---333335672534435533323353---612-111111311--------1----1-21111-1---------------1-122211---------------------------------------------11111111221-1---11-----11-----1-12--------2--11----------------1--1-1--11111111111111--------1------------------1--------------------------1------------------------------------1----111111-------1--------11-----1------------------2----------------------------------------------------------------------------1-----------------1---------------1--------1-------------------------------------------1-1----------------------1-1-----------------------------------------------------------------------------------111-111111----------------------11----------------------------------------24-111111-1-- -------------------1-----------------------------1--------------------------------------------2-------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ STR:NPRED 167 STR:RPRED 94.4 SQ:SECSTR ######cEHTcEEEEccGGGHHHHHHTTTTccEEETTEEEccHHHHHHHHHHHTTccccEEEEEEcTTccEEEEEEEEEEETTTTEEEEEEEEcGGGTTccHHHHHHHHHHHHHHHTccccEEEEEEETTcHHHHHHHHHTTcEEEEEEEEEEEETTEEEEEEEEEEHHHHHH#### DISOP:02AL 176-177| PSIPRED ccccEEEccEEEEEEccHHHHHHHHHHcHHHHHHcccccccccHHHHHHHHHHHHcccccEEEEEEEcccEEEEEEEEEEcccccEEEEEEEEcHHHHcccHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHcccEEEEEEcccEEEccEEEEEEEEEEcHHHHHHHcc //